KEGG   Cricetulus griseus (Chinese hamster): 100751712
Entry
100751712         CDS       T02813                                 

Gene name
Fzd3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100751712 (Fzd3)
   04390 Hippo signaling pathway
    100751712 (Fzd3)
   04150 mTOR signaling pathway
    100751712 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100751712 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100751712 (Fzd3)
  09158 Development and regeneration
   04360 Axon guidance
    100751712 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100751712 (Fzd3)
   05206 MicroRNAs in cancer
    100751712 (Fzd3)
   05205 Proteoglycans in cancer
    100751712 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100751712 (Fzd3)
   05226 Gastric cancer
    100751712 (Fzd3)
   05217 Basal cell carcinoma
    100751712 (Fzd3)
   05224 Breast cancer
    100751712 (Fzd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100751712 (Fzd3)
   05022 Pathways of neurodegeneration - multiple diseases
    100751712 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100751712 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100751712 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100751712 (Fzd3)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100751712 (Fzd3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100751712
NCBI-ProteinID: XP_027246120
UniProt: G3H0J5
LinkDB
Position
1
AA seq 666 aa
MAMSWIVFYLWLLTVFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttttatctttggctcttgactgtgtttgtggggcatata
ggtgggcacagtttattttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaaccattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaacctggactgttctcgggattttcggccattt
ctttgtgcactctatgcccctatttgtatggaatatgggcgtgtcacacttccctgtcgt
aggctgtgtcagcgtgcctatagcgagtgttcaaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggtttccagattgtgatgagccatatccccgactt
gtggatttgaatttagttggagatccaactgaaggcgccccagttgcagtacagagagat
tacggtttttggtgtccccgagagttgaaaattgatccagatcttggctattcctttctg
catgttcgagattgttcaccaccatgtcccaatatgtactttaggagagaagaactgtca
tttgctcgctatttcataggactgatttcaatcatttgcctctctgccacgttgtttact
tttttaacctttttgattgacgtcacaagattccgttaccctgaaaggcctatcatattt
tatgcggtctgctacatgatggtgtcattgattttcttcattggctttttgcttgaggat
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcacaataaagcctgtaccatgctttttatggtactctattttttcactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcctggggcatccctgga
acactaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgtcggcctctacgatgttgatgcattaagatatttcgttctcgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagccggcattatatctctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgatccgg
attggtgttttcagcattctttaccttgtaccactcttggttgtaattggatgttacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaggaacgctgcagagaa
tatcatattccatgtccataccaggttactcagatgagtcgtccagacctgattctcttt
ctgatgaagtatctgatggctctcatagtcgggattccctctatattttgggttggaagc
aaaaagacatgctttgaatgggccagttttttccatggtcgtagaaaaaaagagatagtg
aatgagagccgacaggtgctccaggagcctgactttgctcagtcgctcctgcgggaccca
aatactcctattataagaaaatccagaggaacttccactcaaggaacatccacacatgct
tcttcaactcagctggccatggtggatgatcaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgtgatggcaggtacactccctgc
agttaccgaggaatggaggagagactacctcatggcagcatgtcacgcctgacggatcac
tccaggcacagtagttctcatcggcttaatgagcagtcacgacatagcagcattcgagac
ctcagtaacaaccccatgactcacattacacacggcaccagcatgaaccgtgttattgaa
gaggatgggaccagtgcttag

KEGG   Cricetulus griseus (Chinese hamster): 100755785
Entry
100755785         CDS       T02813                                 

Gene name
Fzd10
Definition
(RefSeq) frizzled-10 isoform X2
  KO
K02842  frizzled 9/10
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100755785 (Fzd10)
   04390 Hippo signaling pathway
    100755785 (Fzd10)
   04150 mTOR signaling pathway
    100755785 (Fzd10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100755785 (Fzd10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100755785 (Fzd10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755785 (Fzd10)
   05205 Proteoglycans in cancer
    100755785 (Fzd10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100755785 (Fzd10)
   05226 Gastric cancer
    100755785 (Fzd10)
   05217 Basal cell carcinoma
    100755785 (Fzd10)
   05224 Breast cancer
    100755785 (Fzd10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100755785 (Fzd10)
   05022 Pathways of neurodegeneration - multiple diseases
    100755785 (Fzd10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100755785 (Fzd10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100755785 (Fzd10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100755785 (Fzd10)
   04090 CD molecules [BR:cge04090]
    100755785 (Fzd10)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100755785 (Fzd10)
CD molecules [BR:cge04090]
 Proteins
  100755785 (Fzd10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100755785
NCBI-ProteinID: XP_027269652
UniProt: G3I1I6
LinkDB
Position
4
AA seq 599 aa
MPGSGGPERLGDSAGATMQHPGPRLWLLLQVMMGSCAAISSMDLERPGDGKCQPVEIPMC
KDIGYNTTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTP
IPACRVMCEQARLKCSPIMEQFKFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPTRGS
GMFPPLFRPQRPHSAQEHSLKDGGPGRAGCDNPGKFHHVEKSESCAPLCTPGVDVYWSRE
DKRFAVIWLAIWSVLCFFSSAFTVLTFLIDPSRFRYPERPIIFLSMCYCVYSVGYIIRLF
AGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKW
GHEAIEANSSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPL
ACYLVIGTSFILSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSLLYTVPATCVIACY
FYERLNMDYWKMLATQHKCKMNNQTKTPDCLMTTSIPAVEVFMVKVSMLLVVGITSGVWV
WTSKTLQSWQQVCSRGLKRKSRRKPASVVTSAGIYKKAQHPQKPHLGKYELPAQPSACV
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgcccgggagcggcggccctgagcggcttggggactccgcgggcgccaccatgcagcac
cccggcccgcgcctgtggctgttgctgcaggtgatgatgggctcttgcgcggccatcagc
tccatggacttggagcgccctggagacggcaagtgccagccggtggagattcccatgtgt
aaggacatcggctacaacaccacccgcatgcccaacctgatgggccacgagaaccagcgc
gaggcggccatccaactgcacgagtttgcgccgctcgtggagtacggctgccacggccac
ctccgcttcttcctgtgctcgctgtatgcgcccatgtgcaccgagcaggtctccacgccc
atccctgcttgccgggtcatgtgcgagcaggcccggctgaagtgctctccgatcatggag
cagttcaaattcaagtggccggactccctggactgcagcaagctccccaacaagaacgac
cccaactacctgtgtatggaggcacccaacaacggctcggacgagccgacccggggctct
ggcatgttccctccgctcttcaggccccagaggccccacagcgcgcaggagcactcgcta
aaggacggaggtcccgggcgtgcaggctgtgacaacccgggcaaattccaccacgtggag
aaaagcgagtcctgcgcgcctctctgtactccgggggtggatgtgtactggagccgcgag
gacaagcgcttcgctgtaatctggctggctatctggtcagtgttgtgcttcttctccagc
gcctttaccgtactcaccttcctcattgacccatcgcgcttcaggtaccccgaacgacct
atcatcttcctctccatgtgctactgtgtctattcggtgggctatatcatccgcctcttc
gctggcgctgagagcatcgcctgcgacagggacagtggacagctgtatgttatccaggag
ggtctggagagcaccggctgtaccttagtctttttggtactttactacttcggcatggcc
agctctttatggtgggtggttctcaccctcacttggttcctggctgctggcaagaagtgg
ggccatgaggccattgaagccaacagcagctactttcacttggcagcctgggccatcccg
gctgtgaagaccatcttgatcctggtgatgcgccgggtggcaggggatgaactcactggt
gtgtgttatgtgggcagcatggatgtcaatgctctgactggcttcgtgctggtccccctg
gcttgctacctggtcatcggcacttccttcatcctgtcaggctttgtggctttatttcac
atcaggagggtaatgaaaacgggtggggagaacacggacaagctggagaagctcatggta
cgcataggggtcttctcccttctctacactgtgccggccacctgtgtgattgcctgctac
ttttatgaacgtctgaacatggactactggaagatgctggccacccagcacaagtgtaag
atgaacaatcagaccaagacacctgattgtctgatgaccacctccatccctgccgtggag
gtcttcatggtcaaagtgtccatgcttctggtggtaggcatcaccagtggggtgtgggtc
tggacctccaagaccctgcaatcctggcaacaggtgtgcagccgagggctaaagagaaag
agccggaggaaaccagccagtgtggtcaccagtgcagggatctacaaaaaagctcagcac
ccccaaaaacctcaccttgggaagtatgagcttcctgcccaaccttcagcctgtgtgtga

KEGG   Cricetulus griseus (Chinese hamster): 100756296
Entry
100756296         CDS       T02813                                 

Gene name
Fzd4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100756296 (Fzd4)
   04390 Hippo signaling pathway
    100756296 (Fzd4)
   04150 mTOR signaling pathway
    100756296 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100756296 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100756296 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100756296 (Fzd4)
   05205 Proteoglycans in cancer
    100756296 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100756296 (Fzd4)
   05226 Gastric cancer
    100756296 (Fzd4)
   05217 Basal cell carcinoma
    100756296 (Fzd4)
   05224 Breast cancer
    100756296 (Fzd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100756296 (Fzd4)
   05022 Pathways of neurodegeneration - multiple diseases
    100756296 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100756296 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100756296 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100756296 (Fzd4)
   04090 CD molecules [BR:cge04090]
    100756296 (Fzd4)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100756296 (Fzd4)
CD molecules [BR:cge04090]
 Proteins
  100756296 (Fzd4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100756296
NCBI-ProteinID: XP_027263396
LinkDB
Position
3
AA seq 535 aa
MAWRGTEPSVPGAPGGVRLGLLLQLLLFLRPALGFGDEEERRCDPIRIAMCQNLGYNVTK
MPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCL
SVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECH
SVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLTFL
IDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNTGC
AIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTIVI
LIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNLQK
DGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIF
MSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggcctggcggggcacagagccgagcgtcccgggggcgcctggaggcgtcaggctgggg
ctgctgctgcagttgctcctgttcttgcggccagcattgggtttcggggacgaggaggag
aggcgctgcgaccccatccgcatcgccatgtgccagaacctcggatacaacgtgaccaag
atgcccaacctggtgggacacgagctgcagacggacgccgagctgcagctgacaactttc
acgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcggtttat
gtgcctatgtgcacagagaagatcaacatccccattggcccgtgtggtggcatgtgtctt
tcagtcaagagacgatgtgaaccagtcctgaaagaatttggttttgcctggccagatagc
ctgaactgcagcaaattcccaccccagaatgaccacaaccatatgtgcatggaaggacca
ggcgatgaagaggtgcccttgcctcacaaaacccccatccagccgggagaagagtgccac
tctgtgggaaccaattctgatcagtatatctgggtaaaaaggagcctgaactgtgttctc
aagtgtggctacgacgctggcttgtatagccgctcagctaaggagttcacggatatttgg
atggcagtgtgggccagcctgtgtttcatctctaccaccttcactgtgttgaccttcctg
atcgattcatccaggttttcttaccctgagcgtcccatcatatttctcagtatgtgctat
aatatttatagcattgcttatattgttcggctgactgtaggccgggaaaggatatcctgt
gattttgaagaggcggcagaacccgttctcatccaagaaggacttaagaacacaggatgt
gcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgggttatt
ctgacacttacttggtttttggcagcaggactcaagtggggtcatgaagccattgaaatg
cacagctcttatttccacattgcagcctgggctatccctgcagtgaaaaccattgtcatc
ttgattatgagactagtagatgccgatgaactcacaggcctgtgctatgttgggaaccaa
aacctagatgctctcactggctttgtggtggctcctctctttacatatttggtgatcgga
actctgttcattgcagcgggtttggtggccttattcaaaattcggtcaaatcttcaaaaa
gatgggacaaagacagacaagttggaaaggttaatggtcaagatcggggttttctcagta
ctgtacacggttcctgcaacctgtgtgattgcctgttacttctatgaaatctctaactgg
gcactctttcggtattctgcagatgactctaatatggcagtggaaatgttgaaaattttt
atgtctttgcttgtgggcatcacttcaggcatgtggatttggtcagccaaaacccttcac
acgtggcaaaaatgttctaaccgattggtgaattctgggaaggtaaagagagagaagagg
gggaatggttgggtgaagccagggaaaggcaatgaaactgtggtataa

KEGG   Cricetulus griseus (Chinese hamster): 100761155
Entry
100761155         CDS       T02813                                 

Gene name
Fzd9
Definition
(RefSeq) frizzled-9 isoform X2
  KO
K02842  frizzled 9/10
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100761155 (Fzd9)
   04390 Hippo signaling pathway
    100761155 (Fzd9)
   04150 mTOR signaling pathway
    100761155 (Fzd9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100761155 (Fzd9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100761155 (Fzd9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100761155 (Fzd9)
   05205 Proteoglycans in cancer
    100761155 (Fzd9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100761155 (Fzd9)
   05226 Gastric cancer
    100761155 (Fzd9)
   05217 Basal cell carcinoma
    100761155 (Fzd9)
   05224 Breast cancer
    100761155 (Fzd9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100761155 (Fzd9)
   05022 Pathways of neurodegeneration - multiple diseases
    100761155 (Fzd9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100761155 (Fzd9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100761155 (Fzd9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100761155 (Fzd9)
   04090 CD molecules [BR:cge04090]
    100761155 (Fzd9)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100761155 (Fzd9)
CD molecules [BR:cge04090]
 Proteins
  100761155 (Fzd9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100761155
NCBI-ProteinID: XP_027272069
LinkDB
Position
4
AA seq 709 aa
MSAPHERPPSFVEGVLPGAVESAKERKGDVAHTSPAWQGGAAPLKLGEGVPGETAPPPGV
SSHWPRPQSSALRRLEPETAPALVERRRRWRWRRGSGCSLTSRRSRDGMERRRVRAPRGD
AATLLRGALLLWQLLARAAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNLLG
HTSQGEAAAQLAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRC
APIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPTEPHKGLGMLPVAPRPARP
PGDSAPGPGSGGTCDNPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALC
FFSTAFTVFTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALY
VIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHMAA
WGLPALKTIVVLTLRKVAGDELTGLCYVASMDPAALTGFVLVPLSCYLVLGTSFLLTGFV
ALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLRATE
QACTAATVPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSLCY
RKMAAGRARAKACRAPGGYGRGTHCHYKGPTVVLHMSKTDPSLENPTHL
NT seq 2130 nt   +upstreamnt  +downstreamnt
atgtcggccccacatgaacggccaccttcgtttgtggaaggcgtgctcccgggggcagta
gagtctgcaaaggaacggaaaggagacgtcgcccacacatctcctgcgtggcagggaggc
gcggcacctttaaagctcggcgagggcgtgcccggcgagacggccccgcccccgggcgtg
tcttcgcactggccacgccctcagagttcggcgctgcggcggctggagccggagaccgcg
ccggctctggtcgagcggcggcggcggtggcggtggcggcgcggcagcggctgttccttg
acgagccgcagatcccgggacgggatggagcggcggcgagtgagagcgccgcggggcgat
gcggccacgctgctccgcggggcgctgctgctgtggcagctgctggcacgggcggcggcg
ctggagatcggccgcttcgatccggagcgcggccgcggtcctgcaccgtgtcaggcggtg
gagatccccatgtgccggggtatcggctacaacttgacccgcatgcctaacctgctgggc
cacacgtcgcagggcgaggcggctgcgcagctggccgagttcgcgcctcttgtgcagtac
ggctgccacagccacctgcgcttcttcctctgctcgctttacgcccccatgtgcaccgac
caggtctccactcccatccccgcttgccggcccatgtgcgagcaagctcgcctgcgctgc
gcccccatcatggagcaattcaatttcggctggcccgactcgctcgactgcgcccggctc
cccacgcgcaacgacccgcacgcgctctgcatggaggcacccgagaacgctaccgcaggc
cccacagaaccccataagggcctgggcatgttacctgtggcacctcggcctgcgagacca
ccgggagattcagctccaggtcccggcagcggtggcacctgtgacaaccccgagaagttc
cagtacgtggagaagagtcgctcgtgcgctccgcgctgcgggccgggcgtcgaggtgttc
tggtctcggcgcgacaaggacttcgcgctcgtctggatggccgtgtggtctgcgttgtgt
ttcttctccacagctttcaccgtcttcacctttctgctggagcctcaccgattccagtac
cccgagcgccccattatctttctttccatgtgctacaacgtctactccttggctttcctg
atccgagcggtggcaggtgcacagagtgtggcctgtgaccaggaggcgggggccctgtat
gtgatccaggagggcctggaaaacacaggctgcaccctggtctttctgttgctctattac
ttcggtatggccagctcactttggtgggtggttttgactctcacctggttcctggctgca
ggcaaaaaatggggccatgaggccattgaggcccatggcagctacttccacatggcagct
tggggcctgccagctctcaagaccatcgtagtcctgacgctgcgcaaggtggccggagat
gagctgactgggctctgctatgtagccagcatggaccccgcagccctcactggctttgtg
ttggtacccctctcttgctacctggtactcggcaccagtttcctcttgaccggttttgtg
gctctcttccatatccgcaaaatcatgaaaacaggtggcaccaacacagagaagctggag
aagttgatggtcaagatcggagtcttctctatcctttacaccgtgccggccacctgcgtc
attgtctgctatgtttacgagcgcctcaacatggacttctggcgccttcgggccactgag
caagcatgcactgcggccactgtgcctggaggccgaagagactgctcgctgccagggggc
tcggtgcccactgtggctgtcttcatgctcaaaatcttcatgtccttagtggtgggcatc
accagtggagtctgggtttggagttccaagactttccagacatggcagagcctgtgctac
cgaaaaatggcagctggccgagcccgggccaaggcctgccgggccccagggggctatggc
cgtggtacccactgccactacaagggccccacggtggtcttgcacatgagtaagacagat
ccctctctggagaaccccacacacctctag

KEGG   Cricetulus griseus (Chinese hamster): 100762351
Entry
100762351         CDS       T02813                                 

Gene name
Fzd5
Definition
(RefSeq) frizzled-5 isoform X2
  KO
K02375  frizzled 5/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100762351 (Fzd5)
   04390 Hippo signaling pathway
    100762351 (Fzd5)
   04150 mTOR signaling pathway
    100762351 (Fzd5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100762351 (Fzd5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100762351 (Fzd5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100762351 (Fzd5)
   05205 Proteoglycans in cancer
    100762351 (Fzd5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100762351 (Fzd5)
   05226 Gastric cancer
    100762351 (Fzd5)
   05217 Basal cell carcinoma
    100762351 (Fzd5)
   05224 Breast cancer
    100762351 (Fzd5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100762351 (Fzd5)
   05022 Pathways of neurodegeneration - multiple diseases
    100762351 (Fzd5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100762351 (Fzd5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100762351 (Fzd5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100762351 (Fzd5)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100762351 (Fzd5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100762351
NCBI-ProteinID: XP_027252904
LinkDB
Position
2
AA seq 586 aa
MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSFPAKPTLPGPPGAPSSGG
ECPSGGQSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCS
SGRGHKSGGAMAAGDYVEASAALTGRTGPPGPAAAAYHKQVSLSHV
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggctcgacccgacccgtccgctccgccctcactgctgctgctgctactagcgcagctg
gtgggccgggcagcggccgcctccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgaggcatcggctacaacctgacgcacatgcccaaccagtttaaccacgacacgcag
gacgaggcaggcctggaggtgcaccaattctggccgctggtggagatccactgctcaccg
gacctgcgcttcttcctgtgctccatgtacacacccatctgcttgccggactaccacaag
ccgctgccaccctgccgctccgtgtgcgagcgcgccaaggccggctgctcgcctctcatg
cgccagtacggcttcgcctggccggagcgcatgagctgcgaccgcctccctgtgctgggc
ggtgacgccgaggttctgtgcatggattataaccgaagcgaagccaccactgcgtccccc
aagtccttccctgccaagcccaccctcccaggcccaccaggggcgccatcttccgggggc
gagtgcccctcgggaggtcaatctgtgtgcacgtgccgtgagcccttcgtgcctatcctg
aaggagtcacaccctctctacaacaaggtgcgcaccggccaggtgcccaactgtgcagtg
ccctgctaccagccgtccttcagccccgatgagcgcacgttcgccaccttctggattggc
ctgtggtctgtactgtgctttatctccacatccaccaccgttgccaccttcctcatcgac
atggaacgattccgctaccctgagcgccccatcatcttcttgtctgcctgctacctgtgt
gtgtcgttgggattcctggtgcgcctggtcgtgggccatgccagcgtcgcctgcagccgc
gagcacagccacatccactatgagactactggccctgcgctgtgcacggtcgtcttcctc
ctagtctacttctttggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcggctggcatgaagtggggcaacgaagccatcgcaggctatgcccagtacttc
catcttgctgcctggctcatccccagcgttaagtccattacagcgctggcactaagctct
gtggacggggacccagtggctggcatctgctatgtgggcaaccaaaatctgaactcgctg
cgtggcttcgtcttgggcccactggtgctctacctactggtgggtacgctcttccttctg
gcgggcttcgtgtcgctcttccgcatccggagtgtcattaagcagggtggcactaagaca
gacaagctggagaagctcatgatccgcattggcatcttcactctgctctacacggtgcca
gccagcattgtggttgcctgctacctgtatgagcagcactaccgagagagctgggaggcg
gccctcacctgcgcgtgtccaggacctgacgctggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctggtggtgggcatcacgtcgggagtctgg
atctggtccggcaagaccctggagtcttggcggcgcttcaccagtcgctgctgctgcagc
tcagggcggggccacaagagtggtggcgctatggccgcaggggactatgtggaggccagc
gccgcgctcaccggcaggaccgggccgcccggccccgccgccgccgcataccacaagcaa
gtgtccctgtcgcatgtctag

KEGG   Cricetulus griseus (Chinese hamster): 100763109
Entry
100763109         CDS       T02813                                 

Gene name
Fzd2
Definition
(RefSeq) frizzled-2 isoform X2
  KO
K02235  frizzled 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100763109 (Fzd2)
   04390 Hippo signaling pathway
    100763109 (Fzd2)
   04150 mTOR signaling pathway
    100763109 (Fzd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100763109 (Fzd2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100763109 (Fzd2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100763109 (Fzd2)
   05205 Proteoglycans in cancer
    100763109 (Fzd2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100763109 (Fzd2)
   05226 Gastric cancer
    100763109 (Fzd2)
   05217 Basal cell carcinoma
    100763109 (Fzd2)
   05224 Breast cancer
    100763109 (Fzd2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100763109 (Fzd2)
   05022 Pathways of neurodegeneration - multiple diseases
    100763109 (Fzd2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100763109 (Fzd2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100763109 (Fzd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100763109 (Fzd2)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100763109 (Fzd2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100763109
NCBI-ProteinID: XP_027283794
LinkDB
Position
7
AA seq 570 aa
MRARSALPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQT
IMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICE
RARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPSGLQPG
AGGTPGGPGGGGAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMF
FSQEETRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYI
AGFVLQERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLA
AGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGF
VLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATI
VIACYFYEQAFREHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITS
GFWIWSGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgcgggcccgcagcgccctgccccgcagcgccctgccccgcttgctgctgccactgctg
ctgctgccggccgctgggccggcccagtttcacggggagaagggcatctccatcccggac
cacggcttctgccagcccatctccatcccgctgtgcacggacatcgcctacaaccagacc
atcatgcccaaccttctcggccacacgaaccaggaggacgcgggcctggaggtgcaccag
ttctacccgctggtgaaggtgcagtgctcgcccgagctgcgtttcttcctgtgctccatg
tacgctccggtgtgcacggtgctggagcaggccatcccgccgtgccgctccatctgcgag
cgcgcgcgccaaggctgcgaggcgctcatgaacaagttcggcttccagtggcccgagcgc
ctccgctgcgagcatttcccgcgtcacggcgcggaacagatctgcgtgggccagaaccac
tccgaggacggagctcctgcgctgctcaccaccgcgccgccctccgggctgcagcctggc
gcgggtggcaccccgggcggccctggcggcggtggcgcgcctccgcgctacgctaccctg
gagcaccctttccactgtccccgcgtcctcaaggtgccgtcctatctcagctataagttt
ctaggtgagcgcgattgtgcagcgccctgcgagcccgcacggcccgacggctccatgttc
ttctcccaggaggagacgcgttttgcccgtctctggatcctcacctggtcggtgctgtgc
tgcgcttccacgttcttcacggtcaccacctacttagtggacatgcagcgctttcggtac
ccagagcggcccatcatctttctgtccggctgctacaccatggtgtcggtggcctacatc
gccggcttcgtgctccaggagcgcgtggtgtgcaacgagcgcttctccgaggacggctac
cgcacggtggtgcagggcaccaagaaagagggctgcactatcctcttcatgatgctgtac
ttctttagcatggccagctccatctggtgggtgattctgtccctcacctggttcctggca
gccgggatgaaatggggccacgaggccatcgaggccaattcgcagtacttccacctggcc
gcctgggccgtgccggccgtcaaaaccatcaccatcctggccatgggccagatcgacggc
gacctgctgagcggcgtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttc
gtgctggcgccgctcttcgtgtacctgttcatcggcacgtcattcctgctggccggcttc
gtgtctctcttccgcatccgcaccatcatgaagcacgatggcaccaagacggagaagctg
gagaggctcatggtgcgcatcggcgtcttctcggtgctctacaccgtgccggccaccatc
gtcatcgcctgctacttctacgagcaggccttccgcgagcactgggagcgctcgtgggta
agccagcactgcaagagcctggccatcccgtgcccggcccactacacgccgcgcatgtcg
cccgatttcacagtctacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcg
ggcttctggatctggtccggcaagacgctgcactcgtggaggaagttttacacgcgtctc
accaacagccggcatggcgagaccaccgtgtga

KEGG   Cricetulus griseus (Chinese hamster): 100766658
Entry
100766658         CDS       T02813                                 

Gene name
Fzd7
Definition
(RefSeq) frizzled-7 isoform X2
  KO
K02432  frizzled 1/7
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100766658 (Fzd7)
   04390 Hippo signaling pathway
    100766658 (Fzd7)
   04150 mTOR signaling pathway
    100766658 (Fzd7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100766658 (Fzd7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100766658 (Fzd7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766658 (Fzd7)
   05205 Proteoglycans in cancer
    100766658 (Fzd7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100766658 (Fzd7)
   05226 Gastric cancer
    100766658 (Fzd7)
   05217 Basal cell carcinoma
    100766658 (Fzd7)
   05224 Breast cancer
    100766658 (Fzd7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100766658 (Fzd7)
   05022 Pathways of neurodegeneration - multiple diseases
    100766658 (Fzd7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100766658 (Fzd7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100766658 (Fzd7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100766658 (Fzd7)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100766658 (Fzd7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 100766658
NCBI-ProteinID: XP_027252793
LinkDB
Position
2
AA seq 572 aa
MRGPGTAASHSPLGLCALLLALLGALPAGTRAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMPPSDGRGRWSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgcggggccccggcactgcggcgtcgcactcgcccctgggcctgtgcgccctgctgctg
gcgcttctgggcgcgctgcctgcgggcacccgggctcagccgtaccacggcgagaagggc
atctcggtaccggaccacggcttctgccagcccatctccatcccgttgtgcacggatatc
gcctacaaccagaccatcttgcccaacctgctgggccacacgaaccaagaggacgccggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctgcgcttc
tttttatgctccatgtacgcgcccgtatgcacggtgctcgaccaagccattcctccgtgc
cgctccctgtgcgagcgcgcccgccaaggctgcgaggctctcatgaacaagttcggcttc
cagtggcctgagcggctgcgttgcgagaacttcccggtgcacggcgccggcgagatctgc
gtgggccagaacacgtctgacggctccgggggcgcgggcggcagtcccaccgcctaccct
actgctccctacctgccagacccgcctttcactgccatgcccccctcagatggcagaggc
cggtggtctttccccttctcgtgcccgcgccagctcaaagtgcccccctacctgggctac
cgcttcctaggtgagcgcgattgcggtgccccgtgtgagcccggccgtgctaacggcctt
atgtactttaaagaggaggagaggcgtttcgcccgcctctgggtgggtgtgtggtcggtg
ctgtgctgcgcctcgacgctcttcacggtgctcacctacctagtggacatgcggcgcttc
agctacccagagcgacccatcatcttcctctcgggctgctacttcatggtggccgtggcg
cacgtggcgggcttcctgctggaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggcatggccagctccatctggtgggtcattctgtccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggctaactcgcagtactttcat
ctggccgcatgggctgtgccggcagtcaagacaatcaccatcttggccatgggccaggtg
gacggggaccttctcagtggagtgtgctacgtgggcctgtctagtgtggatgcgctgcgg
ggcttcgtgcttgcgcccctcttcgtctacctcttcatcggtacgtccttcctcctggcc
ggctttgtgtctctcttccgcattcgcaccatcatgaagcacgacggcaccaagaccgag
aaactggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacggtgccggcc
accatcgtgctggcctgctacttttacgagcaggccttccgcgagcactgggagcgcacc
tggctcctacagacctgcaagagctacgctgtgccctgccctccgggtcacttcccgccc
atgagccccgacttcacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actaccggcttctggatctggtctggcaagaccctgcagtcatggcgtcgtttctaccac
agactcagccacagcagcaagggggagactgcggtatga

KEGG   Cricetulus griseus (Chinese hamster): 100770917
Entry
100770917         CDS       T02813                                 

Gene name
Fzd1
Definition
(RefSeq) frizzled-1 isoform X2
  KO
K02432  frizzled 1/7
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770917 (Fzd1)
   04390 Hippo signaling pathway
    100770917 (Fzd1)
   04150 mTOR signaling pathway
    100770917 (Fzd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100770917 (Fzd1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100770917 (Fzd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770917 (Fzd1)
   05205 Proteoglycans in cancer
    100770917 (Fzd1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100770917 (Fzd1)
   05226 Gastric cancer
    100770917 (Fzd1)
   05217 Basal cell carcinoma
    100770917 (Fzd1)
   05224 Breast cancer
    100770917 (Fzd1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100770917 (Fzd1)
   05022 Pathways of neurodegeneration - multiple diseases
    100770917 (Fzd1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100770917 (Fzd1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100770917 (Fzd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100770917 (Fzd1)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100770917 (Fzd1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100770917
NCBI-ProteinID: XP_027247389
LinkDB
Position
1
AA seq 649 aa
MAEEAAPSESLAAGRPSWELCAGALRDPREEVGRGDTTGRRRPRADPRRWASGLLLLLWL
LEAPLLLGVRAQAAGQVPGPGQQAPPPPQPQPQPQPQQQSGQQYNGERGISIPDHGYCQP
ISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCT
VLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTP
TPSLLPEFWTSNPQHGGGYRGGGYPGGAGPVERGKFSCPRALRVPSYLNYHFLGEKDCGA
PCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFL
SGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYFFSMASSI
WWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCF
VGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIG
VFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQGGGGVPPHPPMSP
DFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggccgaggaggcggcgcctagcgagtccctggccgccggccggccgagctgggaactt
tgtgccggggctctccgggacccgcgggaggaggtggggcgcggggacacgaccggccgc
cgccgtccccgggcggacccccgacgctgggctagtgggctgctgctgctactttggctg
ctggaggccccgctgctgttgggggtccgagcccaggcggcgggccaggtacccgggccg
ggccagcaagccccgccgccgccccagccgcagccgcagccgcagccgcaacagcagagc
gggcagcagtacaacggcgaacggggcatctccatcccggaccacggctactgccagccc
atctccatcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctg
ggccacacgaatcaggaggacgcgggcctggaggtacaccagttctacccgctggtgaag
gtgcagtgctccgccgagctcaagttcttcctgtgctccatgtacgcgcccgtgtgcacc
gtcctggagcaggcgctgccgccctgccgctccctgtgcgagcgcgcgcgccagggctgc
gaggcgctcatgaacaagttcggcttccagtggccagacacgctcaagtgcgagaagttc
ccggtgcacggcgcgggagagctgtgcgtgggccagaacacgtcggacaaaggtaccccg
actccctccttgctgcccgagttctggaccagcaatcctcaacacggcggtggctaccgc
ggtggcggctacccggggggcgccggcccggtggagcggggcaagttctcctgcccccgc
gccctcagggtgccctcctacctcaactaccactttctgggggagaaggactgcggcgcg
ccctgcgaacccaccaaggtgtacgggctcatgtacttcgggccggaggagctgcgcttc
tcgcgcacctggattggcatctggtcggtgctgtgctgcgcctccacgcttttcacggtg
ctcacctacctggtggacatgcggcgcttcagctacccggaacggcccatcattttcctg
tccggctgttacacagcggtggccgtggcctacatcgctggctttctgctggaggaccgg
gtggtgtgtaacgacaagtttgcagaggacggggcgcgcacggtggcgcagggcactaag
aaggagggctgcactatcctctttatgatgctctacttcttcagcatggccagctccatc
tggtgggtgatcctgtccctcacctggttcctggcagccggcatgaagtggggccacgaa
gccatcgaggccaactcacagtattttcacctagccgcctgggctgtgccagccatcaaa
actataaccatcctggcgttgggccaggtggacggcgatgtactgagtggagtgtgtttt
gtagggcttaacaacgtggacgcgctgcgcggctttgtgctggcgccgctcttcgtatac
ctgttcatcggcacctctttcctgctggccggttttgtgtcactcttccgcatccgcacc
atcatgaagcatgacggcaccaagactgaaaagctggagaagctcatggtgcgcatcgga
gtcttcagtgtgctctacacagtgccggccaccatcgtcatcgcctgctacttctatgag
caggccttccgggaccagtgggagcgcagctgggtggcccaaagctgcaagagttatgcc
atcccctgccctcacctccaggggggtggaggagtcccaccacacccgcccatgagcccg
gactttacagtcttcatgatcaaatatctcatgacgctaatcgtgggcatcacatctggc
ttctggatctggtctgggaagacactgaactcctggaggaagttctacacgaggcttacc
aacagcaaacagggggagactaccgtctga

KEGG   Cricetulus griseus (Chinese hamster): 100774509
Entry
100774509         CDS       T02813                                 

Gene name
Fzd6
Definition
(RefSeq) frizzled-6 isoform X2
  KO
K02376  frizzled 6
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100774509 (Fzd6)
   04390 Hippo signaling pathway
    100774509 (Fzd6)
   04150 mTOR signaling pathway
    100774509 (Fzd6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100774509 (Fzd6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100774509 (Fzd6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774509 (Fzd6)
   05205 Proteoglycans in cancer
    100774509 (Fzd6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100774509 (Fzd6)
   05226 Gastric cancer
    100774509 (Fzd6)
   05217 Basal cell carcinoma
    100774509 (Fzd6)
   05224 Breast cancer
    100774509 (Fzd6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100774509 (Fzd6)
   05022 Pathways of neurodegeneration - multiple diseases
    100774509 (Fzd6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100774509 (Fzd6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100774509 (Fzd6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    100774509 (Fzd6)
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  100774509 (Fzd6)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Folate_rec Integrin_alpha
Other DBs
NCBI-GeneID: 100774509
NCBI-ProteinID: XP_035305578
LinkDB
Position
10
AA seq 712 aa
MEMSPFLWLCLFLPAVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQSIAAVEMEH
FLPVANLECSPNVEIFLCHAFVPPCTEQIHVAPPCRKLCEEVYSDCKTLMDTFGIRWPEE
LECNRLPHCDATVPVTPDPHTELLGPQRKTEQVPRDIGFWCPKHLKASGEQGYKFLGIDH
CAPPCPNMYFKTDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNTTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTVTWFLAAGRKWSCEAIEQKAVWFHAVAWGTPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRVTWEITWFSDHCRQYRIPCPFQANPGARPDLALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KQYYKPGSHKLKVISKSMGTSTGAPADHGTSAVAIADHDYLGQETTTEIQTSPDASVKEV
TADRASTPRAKEQDCGEPASPAASSSKLSGEQRCRKGQAGSVKGKSGVSEGTPSEGRVSP
KSDLTETGLVKSSSLQVPSSSEPSSPKGSTSLLAHPASGVRREQGAAGHPDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtctccatttctgtggctgtgccttttcctgcccgcggtgaggggacacagc
ctcttcacctgtgagccaatcactgtccccaggtgcatgaaaatggcctacaatatgaca
ttcttccctaacctgatgggccattatgaccagagcatcgccgctgtggaaatggagcac
tttctgcctgttgcaaatcttgaatgttcaccaaacgttgaaatattcctttgccacgct
ttcgtaccaccctgcacggagcagatccacgtggctcccccttgccgtaaactatgtgag
gaagtgtattctgactgcaaaaccttaatggacacgtttgggatccggtggcccgaagaa
cttgaatgtaacagattgccacactgtgacgccacagttcctgtaactcctgatccacac
acagagctcctgggtcctcagaggaaaacagaacaagtcccaagagacattggcttttgg
tgtccaaagcatcttaaggcttccggagaacaaggctataagtttctggggatcgaccac
tgtgcccctccgtgccccaacatgtattttaaaactgatgagctggactttgccaaaagt
ttcatagggatagtttcaatattttgtctctgtgcaactctgttcacattccttacattt
ttaattgacgttagaagattcaggtacccagagagaccaatcatctattactccgtctgt
tacagcattgtttctctcatgtactttgttgggtttctgctgggcaacaccacagcgtgt
aataaggcggatgaaaagctggagctcggggacacggttgttctgggatcgaagaataag
gcttgcagcgtggtctttatgtttttgtattttttcacaatggcaggcaccgtgtggtgg
gtgattctcaccgtcacttggttcttggctgcaggaagaaagtggagctgtgaggccatt
gaacaaaaagcggtgtggttccacgcggtcgcctggggcacgcctggttttctcaccgtc
atgctgcttgctatgaacaaagttgagggggacaatattagcggggtttgcttcgttggc
ctctacgacctggatgcctctcgctactttgtccttctgcctctgtgtctctgtgtgttt
gttgggctgtctctccttctagctggcatcatttccttgaatcacgttagacaagttata
caacacgacggccgaaaccaagagaaactaaagaagttcatgattcgaattggagtcttc
agtggcctgtatcttgtgcccttggtgacacttctaggttgctacgtctatgagctagtg
aacagggtcacctgggagataacttggttctccgatcattgtcgccagtaccgcatcccg
tgtccttttcaggcaaacccaggagctcgaccagacctggctttatttatgataaaatat
ctgatgacattaatcgttggcatctctgcagtcttctgggttggaagcaaaaagacctgc
acagaatgggccggcttcttcaaacgaaaccgcaagcgagatcccatcagcgaaagccgg
agagtgctgcaagagtcctgcgagtttttcctcaagcacaactctaaagtgaagcataag
aagcaatactacaaaccagggtcacacaagctgaaggtcatttccaagtccatggggacc
agcacgggagcccccgcagatcacggcacgtctgccgtggccatcgctgaccatgactac
ttaggacaagaaacaaccacagagatccaaacctccccggatgcatccgtgaaagaggtg
acagcagacagagcaagcacacccagagcaaaggaacaggactgcggagaaccagcctcc
cctgcagcgtccagctccaagctctccggggaacagcgctgcaggaaaggccaagccggc
agtgtgaaggggaaaagcggtgtgtcggaagggacccccagcgaaggaagggtaagtcca
aagagtgacctcactgaaaccggcctggtgaagagcagcagcctgcaggtccccagttct
tcagaaccgagcagccccaagggttccacttctctgctcgctcacccggcttctggagtt
aggagagagcagggtgctgccggccatccggacacatga

KEGG   Cricetulus griseus (Chinese hamster): 113834637
Entry
113834637         CDS       T02813                                 

Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    113834637
   04390 Hippo signaling pathway
    113834637
   04150 mTOR signaling pathway
    113834637
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    113834637
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    113834637
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113834637
   05205 Proteoglycans in cancer
    113834637
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    113834637
   05226 Gastric cancer
    113834637
   05217 Basal cell carcinoma
    113834637
   05224 Breast cancer
    113834637
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113834637
   05022 Pathways of neurodegeneration - multiple diseases
    113834637
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113834637
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    113834637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cge04030]
    113834637
G protein-coupled receptors [BR:cge04030]
 Frizzled / Smoothened family
  113834637
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 113834637
NCBI-ProteinID: XP_027261291
LinkDB
Position
3
AA seq 684 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGS
GHGRPPGARPPHRGGGSRGSGDTAAAPPSRGGKARPPSGGAAPCEPGCQCRAPMVSVSSE
RHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDME
RFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGSAAAAGAGAA
GAGASGPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFL
AAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRG
FVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVP
AAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVW
VWSGKTLESWRALCTRCCWASKGAAVGAGAGGGGPGGGGPGPGGGGGPGGGGGSLYSDVS
TGLTWRSGTASSMSYPKQMPLSQV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctgctagccgccttggcgctgctgcag
cgctccagcggcgccgccgccgcttcggccaaggagctggcgtgccaggagatcacggtg
ccgctgtgcaagggcatcggttacaactacacctacatgcccaaccagttcaaccacgac
acacaagacgaggcgggcctggaagtgcaccagttctggccgctggtggagatccagtgc
tcccccgacctcaagttctttctgtgcagcatgtacacgcccatctgcctggaagactac
aagaagcctctgccgccttgccgctcggtgtgcgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggtttcgcctggcctgaccgcatgcgctgcgaccggctgcccgag
cagggcaacccggacacactgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgccgccgccgccgccgggcgagcagccgccctccggcagc
ggccacggccgcccgccaggggccaggcccccacaccgtgggggtggcagtaggggcagc
ggggacacggcggctgcgcccccctcgcgcggcgggaaggcgaggccccctagtggtggc
gcggctccctgcgagcccgggtgccagtgccgcgcgccgatggtgagcgtgtccagtgaa
cgccaccccctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccctgc
cataaccccttcttcagccaggatgaacgcgccttcaccgtcttctggatcggcctgtgg
tcggtgctctgcttcgtctctaccttcgccaccgtctccaccttcctcatcgatatggag
cgcttcaagtaccctgagcggcccatcatcttcctctccgcctgctacctcttcgtgtca
gtcgggtacctagtgcgcctggtggcagggcacgagaaggtggcctgcagcggtggcgct
ccgggtgcgggcggagctgggggtgctggcagcgccgcggcggctggcgcgggggcggcg
ggagcgggggcgagcggcccgggcgcgcgcggcgagtacgaggagctgggagccgtggag
cagcacgtgcgctatgagaccactggccccgcgctgtgcacggtggtcttcctccttgtc
tacttctttggcatggccagctccatctggtgggtaatcctgtcgctcacgtggttcctg
gcggctggcatgaagtggggcaacgaggccatcgcaggctattcgcagtacttccacctg
gccgcgtggctggtgcccagcgtcaagtccatcgcggtgttggcgctcagctccgtggac
ggcgacccggtggcaggcatctgctacgtgggcaaccagagcctcgacaacctgcgcggc
ttcgtgctggcaccactggtcatctacctcttcattggcaccatgtttctgttggctggt
ttcgtgtcgctgtttcgaatccgctcggtcatcaagcaacaaggaggcccaaccaagaca
cacaagctggagaagctcatgatccgcctgggcctcttcactgtgctctacacggtgcct
gccgccgtcgttgtcgcctgccttttctatgagcagcacaaccgtccacgctgggaggcc
actcacaactgcccatgccttcgggacctgcagcccgaccaggcacgcaggcccgattat
gcggtcttcatgctcaagtacttcatgtgtctggtagtgggcatcacgtcgggcgtgtgg
gtctggtccggcaagactctggagtcctggcgtgcgctgtgcactcgctgctgctgggcc
agcaagggcgcagccgtaggcgcgggagccggaggcggcggcccggggggcggcggtccg
gggcctggtgggggtgggggacccggcggaggcgggggatctctctacagcgacgtcagc
accggcctgacgtggcggtctggcacggccagctccatgtcttaccctaagcagatgcca
ttgtcccaggtctga

DBGET integrated database retrieval system