KEGG   Cricetulus griseus (Chinese hamster): 100751827Help
Entry
100751827         CDS       T02813                                 

Gene name
Tgm6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100751827 (Tgm6)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100751827 (Tgm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100751827
NCBI-ProteinID: XP_007635597
LinkDB All DBs
Position
Un
AA seq 734 aa AA seqDB search
MSRQVSCRFKSCKNLAEDQIDGSVGTGNKGVRVTKVDWQQSKNAAAHHTQDYPGPELVIR
RGQLFSLTLDLSGVLDSEEALIFTVETGPHASEALHTKAIFQTAELEIGDTWTAAIEEQT
ENTITVSLASPSNAVIGRYLLSARASSRRKHSDRKLGQFILLFNPWCPEDDVFLDSEEER
QEYVLNDSGIIFRGVEKHIRAQGWNYGQFEEDILNICLSILDRSPRHQDDPATDVSHRHD
PVYVTRIISAMVNSNNDRGVVQGQWQGKYGGGTSPLNWRGSVAILQKWFKSRYKPVKYGQ
CWVFAGVMCTVLRCLGIATRVVSNFNSAHDTDGNLSVDKYVDSYGRTLEDLTEDSMWNFH
VWNESWFARQDLGPSYNGWQVLDATPQEESEGMFQCGPASVTAIREGDVHLAHDGPFVCA
EVNADYITWLWHEDQRRERVYSDTKKIGRCISTKAVGSDSRVDITGLYKYPEGSRKERQV
YSKAVKKLLSIEAWGRRRRIRRAGGVRGVWRDDLLEPATKPSITGKFKVLEPPVLGQDLK
LALCLTSLTARAQRVRVNLSGATILYTRKPVAEILRESHTVKLGPQEEKKIPVTISYSQY
KEDLTEDKKILLAAMCLVSKGEKLLVEKDITLEDFITIKVLGPAVVGVAVAVEVLVINPL
SESVKDCMLMVEGSGLLQGQLSIEVPSLQPQERALIQFNITPSKSGPRQLQVDLVSSQFP
DVKGFVIINVATAK
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtctaggcaggtaagctgccgcttcaagagctgcaagaatttggcagaagaccagatt
gatggctcagtgggtacaggcaataaaggagtcagagtcaccaaggtggactggcagcag
tccaaaaatgctgctgctcaccacacccaagattaccctggccctgagctggtgattcga
aggggccagttattcagtctcaccctggatctgagtggagtcctggacagcgaggaggcc
ctcatcttcactgtggagacagggccccatgcatctgaggctctccacaccaaagccatc
ttccagacagcagagctagaaataggtgacacctggacagctgcaatagaggaacagaca
gagaataccatcaccgtcagccttgcgagcccttccaatgcagtcattggccgatacctg
ctgagtgccagggcctcttcccgccggaaacacagtgatcgcaagctgggccagtttatt
ctcctgttcaatccctggtgcccagaggacgacgtgtttctggactcagaggaggagagg
caggagtacgtgcttaacgacagtggcatcattttcagaggcgtggagaagcacatccga
gcccagggctggaactacgggcagtttgaagaggacatcctgaacatctgcctctccatc
ctggaccgaagccctcgtcaccaggatgacccagccaccgatgtgtcccaccgccacgat
ccagtctatgtcactaggatcatcagtgctatggtgaacagcaacaatgaccggggtgtg
gtacaaggtcagtggcagggcaaatacggcggtggcaccagcccactgaactggcgtggc
agcgtggccatcctgcagaagtggttcaagagcagatacaaaccagtcaaatatggccag
tgctgggtctttgctggagtcatgtgcacagtcctcaggtgcctggggattgcaaccagg
gtggtgtccaacttcaactcagcccatgacaccgatggcaatctgagtgtggacaaatat
gtggactcttatggacgaaccctggaggacctgacagaagacagcatgtggaatttccat
gtctggaatgaaagctggtttgcacgacaggacctgggcccatcctataatggctggcag
gttttggatgccacaccccaagaagagagtgaaggcatgttccagtgcggccctgcctca
gtcaccgccatccgtgaaggtgatgtacatctagcccacgatggtcccttcgtctgtgcc
gaggtcaatgcagactacatcacctggctgtggcatgaggaccagcggcgggagcgcgtg
tactcagacacaaagaagattggcaggtgtatcagtaccaaggcagtgggcagtgactct
cgtgtggacatcacgggcctttacaagtatccagaagggtcccggaaggagaggcaggtg
tacagcaaagctgtgaagaaactgctcagcatagaagcctgggggaggaggaggcggatt
cgcagggccgggggcgtgcgtggtgtctggcgtgatgacctcctggaaccggccaccaaa
cccagcatcactggcaagttcaaagtgctggagccaccggtgctcgggcaggacctgaag
ctagcactgtgcttgaccagcctcactgccagggcccagcgggtccgagtcaatctgagt
ggtgccaccatcctctatacccgaaagccagtggcagagatcctgcgtgaatcccacaca
gtcaagctagggccacaagaagagaagaagatcccagtcacaatatcttactctcagtac
aaagaagacctgacagaggacaagaagatcctgctggctgccatgtgccttgtcagtaaa
ggagagaagctactggtggagaaggacattactctggaggacttcatcaccatcaaggtg
cttggcccagcagtggtaggagtggcagttgctgtggaagtgttggtgatcaaccccctc
tcggagagcgtaaaggactgtatgctgatggtggaaggcagtggacttctccaaggacag
ctcagtatcgaggtgcccagcttgcagcctcaggagagggccttgatccaattcaacatt
accccctccaaaagtggcccaaggcagctgcaggtggacctcgtcagctcgcagttcccg
gatgtcaagggctttgtgatcatcaacgtggctacagccaagtga

DBGET integrated database retrieval system