KEGG   Cricetulus griseus (Chinese hamster): 100752014
Entry
100752014         CDS       T02813                                 

Gene name
Crkl
Definition
(RefSeq) crk-like protein isoform X1
  KO
K04438  C-crk adapter molecule crk
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04510  Focal adhesion
cge04666  Fc gamma R-mediated phagocytosis
cge04722  Neurotrophin signaling pathway
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05163  Human cytomegalovirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05211  Renal cell carcinoma
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100752014 (Crkl)
   04012 ErbB signaling pathway
    100752014 (Crkl)
   04015 Rap1 signaling pathway
    100752014 (Crkl)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100752014 (Crkl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100752014 (Crkl)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100752014 (Crkl)
   04062 Chemokine signaling pathway
    100752014 (Crkl)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100752014 (Crkl)
   04935 Growth hormone synthesis, secretion and action
    100752014 (Crkl)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100752014 (Crkl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752014 (Crkl)
   05206 MicroRNAs in cancer
    100752014 (Crkl)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100752014 (Crkl)
   05211 Renal cell carcinoma
    100752014 (Crkl)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100752014 (Crkl)
   05100 Bacterial invasion of epithelial cells
    100752014 (Crkl)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100752014 (Crkl)
   05163 Human cytomegalovirus infection
    100752014 (Crkl)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100752014 (Crkl)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 hSH3
Other DBs
NCBI-GeneID: 100752014
NCBI-ProteinID: XP_027268999
UniProt: G3HFZ9
LinkDB
Position
4
AA seq 303 aa
MSSARFDSADRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLSA
AEENVEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPTVASTPGASINPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
DNE
NT seq 912 nt   +upstreamnt  +downstreamnt
atgtcgtccgccaggtttgattctgcagaccgctctgcctggtacatggggccagtgtct
cgccaggaggctcagacccgtctccagggccagcgccatggcatgttcctagtccgggac
tcctctacctgccccggggactatgtactgtccgtgtccgagaactcgcgtgtctcgcac
tacatcatcaactccctgcccaaccgccgctttaagatcggggaccaggagtttgatcat
ttgccggccttgctggagttctacaagatccactacctggatacgaccaccttaatcgaa
ccagcgcccaggtatccaagcccaccaatgggttctgtctcagcacccaacttgtctgca
gcagaagaaaatgtggaatatgtacggactctgtatgattttcctgggaatgatgctgaa
gacctgccctttaaaaagggggagattctagtgataatagagaagcccgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgttccttatgttgaaaag
cttgtgaggtcttcgccacatggaaagcatggaaataggaattctaatagttacggcatc
ccagaacctgctcacgcatatgctcaacctcagaccacaactcctctacctacagttgcc
agtactcctggggcatcgatcaaccctttgccatccacacagaatggacctgtctttgca
aaagcaatccagaagagagtaccttgtgcttatgacaagactgccttggcattggaggtt
ggtgacattgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaggtgaat
gggcgcaaagggcttttccctttcacacatgttaaaatctttgaccctcaaaacccagat
gacaacgagtga

KEGG   Cricetulus griseus (Chinese hamster): 100762827
Entry
100762827         CDS       T02813                                 

Gene name
Crk
Definition
(RefSeq) adapter molecule crk isoform X2
  KO
K04438  C-crk adapter molecule crk
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04510  Focal adhesion
cge04666  Fc gamma R-mediated phagocytosis
cge04722  Neurotrophin signaling pathway
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05100  Bacterial invasion of epithelial cells
cge05135  Yersinia infection
cge05163  Human cytomegalovirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05211  Renal cell carcinoma
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100762827 (Crk)
   04012 ErbB signaling pathway
    100762827 (Crk)
   04015 Rap1 signaling pathway
    100762827 (Crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100762827 (Crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100762827 (Crk)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100762827 (Crk)
   04062 Chemokine signaling pathway
    100762827 (Crk)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100762827 (Crk)
   04935 Growth hormone synthesis, secretion and action
    100762827 (Crk)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100762827 (Crk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100762827 (Crk)
   05206 MicroRNAs in cancer
    100762827 (Crk)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100762827 (Crk)
   05211 Renal cell carcinoma
    100762827 (Crk)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100762827 (Crk)
   05100 Bacterial invasion of epithelial cells
    100762827 (Crk)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100762827 (Crk)
   05163 Human cytomegalovirus infection
    100762827 (Crk)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100762827 (Crk)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 100762827
NCBI-ProteinID: XP_027282531
LinkDB
Position
7
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactggggccgcttgagccgg
caggaggcggtggcgctattgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtttcggaaaactcgcgtgtctcccactac
atcatcaacagcagcggcccgcgccctccagtgcctccgtcgcccgctcagcctccgccg
ggagtgagtccctcccggctccgaataggagatcaagaatttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacattgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcagagtatgtgcgagccctt
tttgactttaatgggaatgatgaagaagatcttccctttaagaaaggagacatcctgaga
atccgggataagcctgaagagcagtggtggaatgcagaggacagcgaaggaaagaggggg
atgattccagtcccttacgtggagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatttatgcc
agggttatccagaagcgagtccctaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaaccctgat
gaggacttcagctga

DBGET integrated database retrieval system