KEGG   Cricetulus griseus (Chinese hamster): 100752139
Entry
100752139         CDS       T02813                                 

Gene name
Kitlg
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04072  Phospholipase D signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04640  Hematopoietic cell lineage
cge04916  Melanogenesis
cge05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100752139 (Kitlg)
   04014 Ras signaling pathway
    100752139 (Kitlg)
   04015 Rap1 signaling pathway
    100752139 (Kitlg)
   04072 Phospholipase D signaling pathway
    100752139 (Kitlg)
   04151 PI3K-Akt signaling pathway
    100752139 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100752139 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    100752139 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752139 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100752139 (Kitlg)
Cytokines and growth factors [BR:cge04052]
 Growth factors
  Growth factors (RTK binding)
   100752139 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 100752139
NCBI-ProteinID: XP_027249944
LinkDB
Position
1
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMIALNYVTG
MDVLPSHCWLRDMVIQLSLSLTDLLDKFSNISEGLSNYSIIDKLGKIVDDLVECMEENAP
KNVKESPKRPEARLFTPEEFFSIFNRSIDAFKDFTLASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKSPEDQGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQHKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactaaggagatctgcgggaatccagtgactgataatgtaaaagacatc
acaaaattggtggcaaatcttccaaatgactatatgatagccctcaactatgtcaccggg
atggatgttttgcccagtcactgttggttacgagatatggtaatacaactgtcactcagc
ttgactgaccttctggacaagttttcaaatatttctgaaggcttgagcaattactccatc
atagacaagctggggaaaatagtggatgaccttgtggaatgtatggaagaaaatgcacct
aagaatgtaaaagaatcaccgaagaggccagaagccagactctttactcctgaagagttc
ttcagtattttcaataggtccattgatgccttcaaggactttacattggcatcggacact
agtgattgtgtgctttcatcaactttaggtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagctgcaaagtcccctgaagaccagggattacagtggacagccatggcattg
ccggcactcatttctcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagagccgttgaaaatatacagattaatgaagaagataatgagata
agtatgttgcaacacaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system