KEGG   Cricetulus griseus (Chinese hamster): 100752522Help
Entry
100752522         CDS       T02813                                 

Gene name
Galt
Definition
(RefSeq) galactose-1-phosphate uridylyltransferase isoform X2
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
cge04917  Prolactin signaling pathway
Module
cge_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
cge_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100752522 (Galt)
   00520 Amino sugar and nucleotide sugar metabolism
    100752522 (Galt)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100752522 (Galt)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     100752522 (Galt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf HIT
Motif
Other DBs
NCBI-GeneID: 100752522
NCBI-ProteinID: XP_027259108
LinkDB All DBs
Position
2
AA seq 395 aa AA seqDB search
MDSPTWAGDPVNLGGLMSQNGDDPEQRQQASEADAMAATFRASEHQHIRYNPLQDEWVLV
SAHRMKRPWQGQVEPQLLKTVPRYDPLNPLCPGATRANGEVNPHYDSTFLFDNDFPALQP
DAPDPGPSDHPLFRAEAARGVCKVMCFHPWSDVTLPLMSVPEIRAVIDAWASVTEDLGAQ
YPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQNYHSQHGEPLLLEYGRQ
ELLRKERLVLSSEHWLVLVPFWAVWPFQTLLLPRRHVRRLPELTPAERDDLASIMKKLLT
KYDNLFETSFPYSMGWHGAPTGLKTGAAYDHWQLHAHYYPPLLRSATVRKFMVGYEMLAQ
AQRDLTPEQAAERLRALPEVHYCLAKKDKETAAVA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggactcacccacctgggctggcgatcccgtcaatttgggtggtctcatgtcgcaaaac
ggagatgatcctgagcagcgccagcaggcgtcagaggcggacgccatggcagcgaccttc
cgggcgagcgaacaccagcatattcgctacaatccgctccaggatgagtgggtgttagtg
tcggcccatcgcatgaagcggccctggcaaggacaagtggagccccagcttctgaagaca
gtgccccgctatgacccactcaaccctctgtgtcccggggccacacgagccaatggggag
gtgaatccacactatgacagcaccttcctgtttgacaatgacttcccagctctgcagccc
gatgctccggatccaggacccagtgaccatcctctttttcgagcagaggcggccagagga
gtttgtaaggtcatgtgcttccatccctggtcggatgtgacactgccactcatgtcagtc
cctgagatccgagctgtcatcgatgcctgggcttcagtcaccgaggatctgggtgcccag
tatccttgggtgcagatctttgaaaacaaaggagccatgatgggctgttctaacccccac
ccccactgccaggtttgggccagcagtttcctgccagatattgcccagcgtgaagagcga
tcccagcagaactatcacagccagcatggagaacctctgttactggaatatggccgccaa
gaactcctcaggaaggaacgtctggtcttatctagtgagcactggctagtcctggtcccc
ttctgggcagtgtggcctttccagacactactgctgccccgccggcatgtacgtcggcta
cctgagctgacccctgctgaacgtgatgatctagcctccatcatgaagaagctattgacc
aagtatgacaacctatttgagacatcttttccctactccatgggctggcatggggctccc
acgggattaaagactggagccgcctatgaccactggcagctacatgctcattactatccc
ccactcctgcgctctgctactgtccggaaattcatggttggctatgaaatgcttgcccag
gctcagcgggacctcactcctgaacaggctgcagagagactaagggcgcttcctgaggta
cattattgcctggcaaagaaagacaaggaaacagcagctgttgcttga

DBGET integrated database retrieval system