KEGG   Cricetulus griseus (Chinese hamster): 100752709Help
Entry
100752709         CDS       T02813                                 

Gene name
Gla
Definition
(RefSeq) alpha-galactosidase A isoform X3
  KO
K01189  alpha-galactosidase [EC:3.2.1.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00561  Glycerolipid metabolism
cge00600  Sphingolipid metabolism
cge00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cge01100  Metabolic pathways
cge04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100752709 (Gla)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100752709 (Gla)
   00600 Sphingolipid metabolism
    100752709 (Gla)
  09107 Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100752709 (Gla)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100752709 (Gla)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100752709 (Gla)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Melibiase_C SAND Chromo
Motif
Other DBs
NCBI-GeneID: 100752709
NCBI-ProteinID: XP_027288630
LinkDB All DBs
Position
X
AA seq 422 aa AA seqDB search
MTMKLLSGDPRLVCELALRPLVLVFWSILGTKALDNGLARTPTMGWLHWERFMCNLDCQE
EPDACISEQLFMQMADLMVSEGWKDAGYEYLCIDDCWMAPERDSKGRLQADPQRFPSGIQ
HLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCHCDSVT
SLADGYKYMSLALNRTGRSIVYSCEWPLYMRPFHKPNYTDIQYYCNYWRNYDDIYDSWES
IKNILAWTTDNQKEIVEVAGPGGWNDPDMLVIGNFGLSWDQQVTQMALWAIMAAPLLMSN
DLRQISSQAKALLQNEDVIAVNQDPLGKQGYCFRKENKIEVWERPLSNLAWAVAVRNLQE
IGGPRSYTIQVASLGQGIACNPGCIITQLLPEKVQLGFYEWTVTLKTRINPSGTVLLRLD
YI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgaagcttttaagtggggatccgcggctggtctgtgagcttgcgcttcgtccc
ctagtcttagttttctggagtattcttgggaccaaagcactggacaacggcttggcgcgg
actcctactatgggctggctgcactgggaacgtttcatgtgcaacctcgactgccaagaa
gagcctgatgcctgcatcagtgagcagctgttcatgcagatggcagaccttatggtctct
gagggctggaaggacgcaggttatgaatacctctgcatagatgactgttggatggctcct
gaaagggactcaaagggccgacttcaggcagatccccagcgctttcctagtggaatccag
cacctagctaattatgtccacagcaaaggattgaagctaggaatttatgcagatgttggg
aataaaacctgtgcaggtttccctgggagttttgggtactatgatattgatgcccagaca
tttgctgactggggtgtagatctgctaaaatttgatggttgtcactgtgacagtgtgacg
tccttggcagatggttataagtacatgtccttggccttgaataggactggcagaagcatt
gtatactcctgtgagtggccgctttatatgagaccctttcataagcccaattatacagat
atccaatattattgcaattactggagaaattatgatgatatttatgattcctgggaaagc
ataaagaatatcttggcctggacaacagataaccagaaggagattgttgaagtcgctgga
ccagggggttggaatgacccagatatgttagtgattggcaactttggcctgagttgggac
cagcaggtaacacagatggccctctgggctatcatggcagctcctctactcatgtccaat
gatctccgacaaatcagctcccaagccaaagctctccttcagaatgaagatgtaattgct
gtcaaccaagaccccttgggcaagcaggggtactgttttagaaaggaaaacaaaatcgaa
gtttgggaacgaccactctcaaatttagcctgggctgtggctgtgagaaacctgcaggaa
attggtggacctcgttcttacaccatccaggtggcttcccttggtcaaggaatagcctgc
aatcctggttgcatcatcacacagctcctccctgagaaagtacagctaggcttctatgaa
tggaccgtaaccttaaaaactcgaataaatccctcaggcactgttctgcttcgactagac
tatatctaa

DBGET integrated database retrieval system