KEGG   Cricetulus griseus (Chinese hamster): 100752721
Entry
100752721         CDS       T02813                                 

Gene name
Hdac1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04213  Longevity regulating pathway - multiple species
cge04330  Notch signaling pathway
cge04613  Neutrophil extracellular trap formation
cge04919  Thyroid hormone signaling pathway
cge05016  Huntington disease
cge05031  Amphetamine addiction
cge05034  Alcoholism
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100752721 (Hdac1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100752721 (Hdac1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100752721 (Hdac1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100752721 (Hdac1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100752721 (Hdac1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752721 (Hdac1)
   05202 Transcriptional misregulation in cancer
    100752721 (Hdac1)
   05206 MicroRNAs in cancer
    100752721 (Hdac1)
   05203 Viral carcinogenesis
    100752721 (Hdac1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100752721 (Hdac1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100752721 (Hdac1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100752721 (Hdac1)
   05034 Alcoholism
    100752721 (Hdac1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100752721 (Hdac1)
   05165 Human papillomavirus infection
    100752721 (Hdac1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100752721 (Hdac1)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100752721 (Hdac1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100752721 (Hdac1)
   HDAC complexes
    Sin3A-HDAC complex
     100752721 (Hdac1)
    BRAF-HDAC complex
     100752721 (Hdac1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100752721 (Hdac1)
  Chromatin remodeling factors
   NuRD complex
    100752721 (Hdac1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100752721
NCBI-ProteinID: XP_027255187
UniProt: G3H942
LinkDB
Position
2
AA seq 482 aa
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVIEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttattactacgacggtgatgttgga
aactactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaat
gctgaggagatgactaagtaccacagtgatgactacattaagttcttgcgttccattcgc
ccagacaatatgtctgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcttgtttgagttctgtcagctgtctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacattgctgtgaactgggctgggggtctgcat
catgcaaagaagtctgaagcatccggtttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcatcatggc
gatggtgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggaccttcgggatattggggctggcaaaggcaag
tactatgctgttaactaccctctccgagatgggattgatgatgagtcctatgaagccatt
ttcaagccagtcatgtccaaagtgatggagatgttccagcctagtgcagtagtcttacag
tgtggctcagattccttatctggagaccggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggagtttgtcaagagtttcaacttgcctatgctaatgctgggagga
ggtggatataccatccgtaatgttgctcggtgctggacttacgaaacagctgtggccctg
gacacggagatccctaatgagctaccgtacaatgactactttgaatactttggaccagac
ttcaagcttcatatcagcccttccaatatgaccaaccagaacactaacgaatacctggag
aaaatcaagcagaggctctttgagaacttgagaatgctgccccatgcgcctggcgtccaa
atgcaggcaatacctgaggatgccatcccagaggagagtggtgatgaggatgaagaagac
cctgacaaacgcatctccatctgttcttctgacaaacgaattgcctgtgaggaagaattc
tctgattcagatgaggagggagaaggtggtcgcaagaattcttctaatttcaaaaaagcc
aaaagagtcaaaacagaggatgaaaaagaaaaagatccagaagagaaaaaagaagtcatc
gaagaggagaagaccaaggaggagaagccagaagccaaaggggtgaaagaagaggtcaag
ctagcctga

KEGG   Cricetulus griseus (Chinese hamster): 100761556
Entry
100761556         CDS       T02813                                 

Definition
(RefSeq) histone deacetylase 1-like
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04213  Longevity regulating pathway - multiple species
cge04330  Notch signaling pathway
cge04613  Neutrophil extracellular trap formation
cge04919  Thyroid hormone signaling pathway
cge05016  Huntington disease
cge05031  Amphetamine addiction
cge05034  Alcoholism
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100761556
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100761556
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100761556
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100761556
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100761556
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100761556
   05202 Transcriptional misregulation in cancer
    100761556
   05206 MicroRNAs in cancer
    100761556
   05203 Viral carcinogenesis
    100761556
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100761556
  09164 Neurodegenerative disease
   05016 Huntington disease
    100761556
  09165 Substance dependence
   05031 Amphetamine addiction
    100761556
   05034 Alcoholism
    100761556
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100761556
   05165 Human papillomavirus infection
    100761556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100761556
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100761556
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100761556
   HDAC complexes
    Sin3A-HDAC complex
     100761556
    BRAF-HDAC complex
     100761556
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100761556
  Chromatin remodeling factors
   NuRD complex
    100761556
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100761556
NCBI-ProteinID: XP_035298589
LinkDB
Position
3
AA seq 482 aa
MAQTQGTKRKVCYYYDSDVGNYYYGQGHPMKPLQIRMTHNLLFNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLHSICPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLVILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYVAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDQLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVAQDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHVPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIVYEEEF
SDSDEKGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVLEEEKTKEEKPEVKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcacagactcagggcaccaagaggaaagtctgttattactacgacagtgatgttgga
aactactattatggacaaggccacccaatgaagcctctccaaatccgcatgactcacaat
ttgctgttcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaat
gctgaggagatgactaagtaccacagtgatgactacattaagttcttgcattccatttgc
ccagacaatatgtctgagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtatttgatggcttgtttgagttctgtcagctgtctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacagacattgctgtgaactgggctgggggtctgcat
catgcaaagaagtctgaagcatccggtttctgttacgtcaatgatatcgtcttggtcatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcatcatggc
gatggtgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggaccttcgggatattggggctggcaaaggcaag
tactatgctgttaactaccctctccgagatgggattgatgatgagtcctatgtagccatt
ttcaagccagtcatgtccaaagtgatggagatgttccagcctagtgcagtagtcttacag
tgtggctcagattccctatctggagaccagttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggagtttgtcaagagtttcaacttgcctatgctaatgctgggagga
ggtggctataccatccgtaatgttgctcggtgctggacttacgaaacagctgtggcccag
gacacggagatccctaatgagctaccgtacaatgactactttgaatactttggaccggac
ttcaagcttcacatcagcccttccaatatgaccaaccagaacactaacgaatacctggag
aaaatcaagcagaggctctttgagaacttgagaatgctgccccatgtgcctggcgtccaa
atgcaggcaatacctgaggatgccatcccagaggagagtggtgatgaggatgaagaagac
cctgacaaacgcatctccatctgttcttctgacaaacgaattgtctatgaggaagaattc
tctgattcagatgagaagggagaaggtggtcgcaagaactcttctaatttcaaaaaagcc
aaaagagtcaaaacagaggatgaaaaagaaaaagatccagaagagaaaaaagaagtcctc
gaagaggagaagaccaaggaggagaagccagaagtcaaaggggtgaaagaagaggtcaag
ctagcctga

KEGG   Cricetulus griseus (Chinese hamster): 100764557
Entry
100764557         CDS       T02813                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2 isoform X2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04213  Longevity regulating pathway - multiple species
cge04330  Notch signaling pathway
cge04613  Neutrophil extracellular trap formation
cge04919  Thyroid hormone signaling pathway
cge05016  Huntington disease
cge05031  Amphetamine addiction
cge05034  Alcoholism
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100764557 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100764557 (Hdac2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100764557 (Hdac2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100764557 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100764557 (Hdac2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764557 (Hdac2)
   05202 Transcriptional misregulation in cancer
    100764557 (Hdac2)
   05206 MicroRNAs in cancer
    100764557 (Hdac2)
   05203 Viral carcinogenesis
    100764557 (Hdac2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100764557 (Hdac2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100764557 (Hdac2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100764557 (Hdac2)
   05034 Alcoholism
    100764557 (Hdac2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100764557 (Hdac2)
   05165 Human papillomavirus infection
    100764557 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100764557 (Hdac2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100764557 (Hdac2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100764557 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     100764557 (Hdac2)
    BRAF-HDAC complex
     100764557 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100764557 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    100764557 (Hdac2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100764557
NCBI-ProteinID: XP_027257939
LinkDB
Position
2
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEESGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDSSGEKTDSKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactactatgacggtgatatt
ggaaattattattatggccagggtcatcccatgaagcctcatagaatccggatgactcat
aacttgctgctaaattatggtttataccgaaaaatggaaatatataggcctcataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtatatcaaatttctacgatcgata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaacgttggagaagat
tgtccagtatttgatggactctttgagttttgtcagctctccactggtggttcagttgct
ggggctgtgaagttaaaccggcaacaaactgatatggctgtcaactgggccggaggatta
catcatgccaaaaagtcagaagcatcaggattctgctatgttaatgatattgtacttgcc
atccttgagttactaaagtaccatcagagagtcttgtatatcgacatagacatccatcat
ggtgatggtgttgaggaagctttttatacaacagatcgtgtgatgacagtttcattccat
aagtatggggaatactttcctggaacaggagatttgagggatattggtgctggaaaagga
aagtactatgctgtcaactttcccatgagagatggtatagatgatgagtcctatggacaa
atttttaagcctataatctcaaaagtgatggagatgtaccagcctagtgctgtggtgctg
cagtgtggtgcagactcactgtctggtgataggcttggctgcttcaatctcactgtcaaa
ggtcatgctaaatgtgtagaagtagtaaaaactttcaacttgccattgctgatgcttggt
ggaggtggctatacaatccgaaacgttgctcggtgttggacatatgagactgcagttgcc
ctggattgtgaaattcctaatgagttgccatataatgattactttgagtattttggaccg
gatttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatcttcgaatgttgccacatgcacctggcgtt
caaatgcaagcgattccagaagatgctgttcatgaagagagcggggatgaggatggagaa
gatccggacaagcggatttcgattcgtgcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggcgaaggaggtcgtcggaatgttgctgatcataagaaa
ggagcaaagaaagctaggattgaagaggacaagaaggagacagaggacaaaaagacagat
gttaaggaagaagacaaatccaaggacagtagtggtgaaaaaacagattccaaaggagcc
aaatcagaacaactcagcaacccttga

DBGET integrated database retrieval system