KEGG   Cricetulus griseus (Chinese hamster): 100752928
Entry
100752928         CDS       T02813                                 

Gene name
Rb1
Definition
(RefSeq) LOW QUALITY PROTEIN: retinoblastoma-associated protein isoform X2
  KO
K06618  retinoblastoma-associated protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04110  Cell cycle
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100752928 (Rb1)
   04218 Cellular senescence
    100752928 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752928 (Rb1)
   05203 Viral carcinogenesis
    100752928 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100752928 (Rb1)
   05225 Hepatocellular carcinoma
    100752928 (Rb1)
   05226 Gastric cancer
    100752928 (Rb1)
   05214 Glioma
    100752928 (Rb1)
   05220 Chronic myeloid leukemia
    100752928 (Rb1)
   05218 Melanoma
    100752928 (Rb1)
   05219 Bladder cancer
    100752928 (Rb1)
   05215 Prostate cancer
    100752928 (Rb1)
   05224 Breast cancer
    100752928 (Rb1)
   05222 Small cell lung cancer
    100752928 (Rb1)
   05223 Non-small cell lung cancer
    100752928 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100752928 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100752928 (Rb1)
   05161 Hepatitis B
    100752928 (Rb1)
   05160 Hepatitis C
    100752928 (Rb1)
   05163 Human cytomegalovirus infection
    100752928 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100752928 (Rb1)
   05169 Epstein-Barr virus infection
    100752928 (Rb1)
   05165 Human papillomavirus infection
    100752928 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100752928 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100752928 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100752928 (Rb1)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100752928 (Rb1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    100752928 (Rb1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 100752928
NCBI-ProteinID: XP_027245948
LinkDB
Position
1
AA seq 920 aa
MPPKAPRRAAAAEPAAXPPPPREDDPGQDSGPEELPLARLEFEEIEEPEFTALCQKLKIP
DHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFVAAVDLDEMPFTFTELQKTIETS
VYKFFDLLKEIDTSTKVDNAVSRLLKKYNVLCALYSKLERTCELIYLTQPSSVISTEINS
MLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVIDYFIKFSPPALLREPYKTAVIPIN
GSPRTPRRGQNRSTRIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIVS
SNGLPEVESLSKRYEELYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKSNPDEEAN
VVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIFK
EKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLL
ACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVETNLTREMI
KHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDHLESACPLSLPLQSNHTAADMYLS
PIRSPKKRSSTTRVNSATNTETQAASALHTQKPLKSTSLSLFYKKVYRLAYLRLNTLCAR
LLSDHPELEHIIWTLFQHTLQNEYELMKDRHLDQIMMCSMYGICKVKNIDLKFKIIVTAY
KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRS
PYKFSSSPLRIPGGNIYISPLKSPYKTSEGLPTPTKMTPRSRILVSIGESFGTSEKFQKI
NQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTR
TRMQKQKMNDIMDISNKEEK
NT seq 2763 nt   +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagagcggcggccgccgagcccgccgccngcccgccgccg
cctcgggaggacgaccccgggcaggacagcggccccgaagagctgcccctggccaggctt
gagtttgaagaaattgaagaacctgaatttactgcattatgtcaaaaattaaagataccg
gatcatgtcagagaaagagcttggttaacttgggagaaagtttcatctgtggatggaatc
ctggaaggatatattcaaaagaagaaggaactctggggcatctgcatctttgttgcagca
gttgacctagatgagatgccattcacttttactgagctacagaaaaccatagaaaccagt
gtctataaattctttgacttactaaaagaaattgataccagtaccaaagttgataatgct
gtgtcaagactattgaagaagtacaatgtgttatgtgcactctacagcaaattagaacgg
acatgtgaacttatatatttgacacaacccagcagtgtgatatctactgaaataaattct
atgttggtgctaaaaatttcttggatcacttttttgctagctaaaggagaagtattacaa
atggaagatgatctggtaatctcatttcagttaatgttgtgtgtaattgactattttatt
aagttctcacctcctgcactactccgagaaccatacaaaacagcagtaatacccattaat
ggttcacctcgaacacccagaagaggtcagaacaggagtacccggatagcaaaacaacta
gaaaatgatacaagaattattgaagttctctgtaaagaacatgaatgtaatatagatgag
gtgaaaaatgtttatttcaaaaattttatcccttttatcaattcacttggaattgtatca
tctaatgggcttccagaggttgaaagtctctctaaacgctacgaagaactttatcttaaa
aacaaagatttagatgcaagactatttttggatcatgataaaacacttcagactgatcct
atagacagttttgaaacagagaggacaccgcgaaaaagcaaccctgatgaagaggcaaat
gtggttactccacacactccagttaggactgttatgaatactatccaacaattaatggtg
attttaaattctgcaagcgatcaaccatcagaaaatctgatttcctatttcaataattgc
acagtgaatccaaaagaaaatatcctgaaaagagtaaaggatgttggacacatctttaaa
gagaagtttgctaatgctgtggggcaggggtgtgttgacattggagtacagcgatataaa
cttggggttcgattatattatcgtgtgatggaatccatgcttaagtcggaagaagaacgt
ttatctattcagaattttagcaaactcctaaatgacaacatctttcatatgtctttattg
gcctgtgctcttgaagttgtaatggctacatatagcagaagtacatcacagaatcttgat
tctggaacagatttgtccttcccgtggattctgaatgtacttaatttaaaagcctttgat
ttttacaaagtgattgaaagttttatcaaagtggaaaccaacttgacaagagaaatgata
aaacatttagaaagatgtgagcatcgaatcatggaatcccttgcatggctttcagactca
cctttatttgatctcatcaagcagtccaaagatggagaaggacccgatcaccttgagtct
gcttgtcctctcagccttcctctccagagtaaccacactgcagcagatatgtatctttct
cctataagatctccaaagaaaagaagttcaactacacgtgtaaattctgctacaaataca
gagacacaagcagcctcagccttacacactcagaagccattgaaatctacctccctttcc
ctattttacaaaaaagtgtaccgtctagcatatctccgcctaaatacactatgtgcacgc
cttctgtctgaccatccagaactagagcatattatctggactctgtttcagcatacactg
caaaatgagtatgagctcatgaaagaccggcatttagaccagatcatgatgtgctctatg
tacggcatctgcaaagtaaagaacattgaccttaaattcaaaatcatcgttactgcatac
aaggatcttccccacgcagcccaggagacctttaaacgtgttttaatcagagaagaggag
tttgattccattatagtattctataactccgttttcatgcagaggctaaaaacaaatatt
ttacagtatgcctccaccaggcctcctaccttgtcaccaatacctcacattcctcgaagc
ccttacaagttttctagttcacccttacggattcctggaggtaacatctatatatcaccc
ctaaagagtccttataaaacttcagaaggtctgccaacacccacaaaaatgactccaaga
tcaagaatcttggtctcaattggtgaatcatttgggacatctgagaagttccagaaaata
aaccagatggtgtgtaatagtgaccgagtgctcaagagaagtgctgaaggtggcaaccct
cccaagccactgaaaaagctgcgctttgacattgagggatccgatgaagcagatggaagt
aaacatctcccagcagagtccaaattccaacagaaactggcagaaatgacttctactcga
acacgaatgcaaaagcagaaaatgaatgatatcatggatatctcaaacaaggaagaaaag
tga

DBGET integrated database retrieval system