KEGG   Cricetulus griseus (Chinese hamster): 100753149
Entry
100753149         CDS       T02813                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04148  Efferocytosis
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04350  TGF-beta signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04520  Adherens junction
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04611  Platelet activation
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04713  Circadian entrainment
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05133  Pertussis
cge05135  Yersinia infection
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05171  Coronavirus disease - COVID-19
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05207  Chemical carcinogenesis - receptor activation
cge05208  Chemical carcinogenesis - reactive oxygen species
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100753149 (Mapk3)
   04012 ErbB signaling pathway
    100753149 (Mapk3)
   04014 Ras signaling pathway
    100753149 (Mapk3)
   04015 Rap1 signaling pathway
    100753149 (Mapk3)
   04350 TGF-beta signaling pathway
    100753149 (Mapk3)
   04370 VEGF signaling pathway
    100753149 (Mapk3)
   04371 Apelin signaling pathway
    100753149 (Mapk3)
   04668 TNF signaling pathway
    100753149 (Mapk3)
   04066 HIF-1 signaling pathway
    100753149 (Mapk3)
   04068 FoxO signaling pathway
    100753149 (Mapk3)
   04072 Phospholipase D signaling pathway
    100753149 (Mapk3)
   04071 Sphingolipid signaling pathway
    100753149 (Mapk3)
   04024 cAMP signaling pathway
    100753149 (Mapk3)
   04022 cGMP-PKG signaling pathway
    100753149 (Mapk3)
   04151 PI3K-Akt signaling pathway
    100753149 (Mapk3)
   04150 mTOR signaling pathway
    100753149 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100753149 (Mapk3)
   04148 Efferocytosis
    100753149 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100753149 (Mapk3)
   04210 Apoptosis
    100753149 (Mapk3)
   04218 Cellular senescence
    100753149 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100753149 (Mapk3)
   04520 Adherens junction
    100753149 (Mapk3)
   04540 Gap junction
    100753149 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100753149 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100753149 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100753149 (Mapk3)
   04613 Neutrophil extracellular trap formation
    100753149 (Mapk3)
   04620 Toll-like receptor signaling pathway
    100753149 (Mapk3)
   04621 NOD-like receptor signaling pathway
    100753149 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    100753149 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    100753149 (Mapk3)
   04660 T cell receptor signaling pathway
    100753149 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    100753149 (Mapk3)
   04659 Th17 cell differentiation
    100753149 (Mapk3)
   04657 IL-17 signaling pathway
    100753149 (Mapk3)
   04662 B cell receptor signaling pathway
    100753149 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    100753149 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    100753149 (Mapk3)
   04062 Chemokine signaling pathway
    100753149 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100753149 (Mapk3)
   04929 GnRH secretion
    100753149 (Mapk3)
   04912 GnRH signaling pathway
    100753149 (Mapk3)
   04915 Estrogen signaling pathway
    100753149 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    100753149 (Mapk3)
   04917 Prolactin signaling pathway
    100753149 (Mapk3)
   04921 Oxytocin signaling pathway
    100753149 (Mapk3)
   04926 Relaxin signaling pathway
    100753149 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    100753149 (Mapk3)
   04919 Thyroid hormone signaling pathway
    100753149 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    100753149 (Mapk3)
   04916 Melanogenesis
    100753149 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100753149 (Mapk3)
   04270 Vascular smooth muscle contraction
    100753149 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100753149 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100753149 (Mapk3)
   04725 Cholinergic synapse
    100753149 (Mapk3)
   04726 Serotonergic synapse
    100753149 (Mapk3)
   04720 Long-term potentiation
    100753149 (Mapk3)
   04730 Long-term depression
    100753149 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    100753149 (Mapk3)
   04722 Neurotrophin signaling pathway
    100753149 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    100753149 (Mapk3)
   04380 Osteoclast differentiation
    100753149 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100753149 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100753149 (Mapk3)
   05206 MicroRNAs in cancer
    100753149 (Mapk3)
   05205 Proteoglycans in cancer
    100753149 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    100753149 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    100753149 (Mapk3)
   05203 Viral carcinogenesis
    100753149 (Mapk3)
   05230 Central carbon metabolism in cancer
    100753149 (Mapk3)
   05231 Choline metabolism in cancer
    100753149 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100753149 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100753149 (Mapk3)
   05212 Pancreatic cancer
    100753149 (Mapk3)
   05225 Hepatocellular carcinoma
    100753149 (Mapk3)
   05226 Gastric cancer
    100753149 (Mapk3)
   05214 Glioma
    100753149 (Mapk3)
   05216 Thyroid cancer
    100753149 (Mapk3)
   05221 Acute myeloid leukemia
    100753149 (Mapk3)
   05220 Chronic myeloid leukemia
    100753149 (Mapk3)
   05218 Melanoma
    100753149 (Mapk3)
   05211 Renal cell carcinoma
    100753149 (Mapk3)
   05219 Bladder cancer
    100753149 (Mapk3)
   05215 Prostate cancer
    100753149 (Mapk3)
   05213 Endometrial cancer
    100753149 (Mapk3)
   05224 Breast cancer
    100753149 (Mapk3)
   05223 Non-small cell lung cancer
    100753149 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100753149 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    100753149 (Mapk3)
   05161 Hepatitis B
    100753149 (Mapk3)
   05160 Hepatitis C
    100753149 (Mapk3)
   05171 Coronavirus disease - COVID-19
    100753149 (Mapk3)
   05164 Influenza A
    100753149 (Mapk3)
   05163 Human cytomegalovirus infection
    100753149 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100753149 (Mapk3)
   05165 Human papillomavirus infection
    100753149 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100753149 (Mapk3)
   05135 Yersinia infection
    100753149 (Mapk3)
   05133 Pertussis
    100753149 (Mapk3)
   05152 Tuberculosis
    100753149 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100753149 (Mapk3)
   05140 Leishmaniasis
    100753149 (Mapk3)
   05142 Chagas disease
    100753149 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100753149 (Mapk3)
   05020 Prion disease
    100753149 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    100753149 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    100753149 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100753149 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100753149 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100753149 (Mapk3)
   04934 Cushing syndrome
    100753149 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100753149 (Mapk3)
   01524 Platinum drug resistance
    100753149 (Mapk3)
   01522 Endocrine resistance
    100753149 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100753149 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100753149 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100753149 (Mapk3)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100753149 (Mapk3)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100753149 (Mapk3)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100753149 (Mapk3)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100753149 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 100753149
NCBI-ProteinID: XP_027260431
UniProt: A0A8C2QI80
LinkDB
Position
3:complement(73975819..73982060)
AA seq 379 aa
MAAAAAPGGGGGEPRGAAGVGPGVPGEVEVVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEDALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERL
KELIFQETARFQPGAPEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctccggggggcgggggcggggagccccggggagccgctggggtc
ggcccgggggtcccgggggaggtggaggtggtgaagggacagccattcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtatggcatggtcagctctgcttat
gaccacgtgcgcaagactagagtggccatcaagaagatcagccccttcgagcaccaaacc
tactgccagcgcacactgagagaaatccagatcttgctgcgattccgccatgagaatgtc
ataggcatccgagacatcctccgagcacccaccctggaagccatgagggatgtttacatt
gttcaggacctcatggagacagacctgtacaagctgcttaagagccagcagctgagcaat
gaccatatctgctacttcctctaccagatccttcggggcctcaagtacatacactcagcc
aatgtgctccaccgggacctgaagccctccaacctgcttatcaataccacctgcgacctt
aagatctgtgattttggcctggcccggattgctgaccctgagcatgaccacactggcttt
ctgacggagtatgtggccacacgttggtaccgagccccagagatcatgcttaactctaag
ggctacaccaaatccatcgacatctggtctgtgggctgcattctggctgagatgctctcc
aaccggcccatcttccccggcaagcactatctggaccagctcaaccacattctaggtatc
ttgggctccccatcccaggaggaccttaattgcatcatcaacatgaaggctcgaaactac
ctacagtctctgccctctaaaactaaggtggcatgggccaagctttttcccaaatctgac
tccaaagctcttgacctgctggaccggatgttaaccttcaaccccaacaagcgcatcaca
gtagaggacgcactggctcacccgtacctggaacagtactatgacccaacagatgagcca
gtggctgaggagcccttcacttttgacatggagctggatgatctccccaaggagaggctg
aaggaactgatcttccaagagacagcccgcttccagccaggggcaccagaggccccctaa

DBGET integrated database retrieval system