KEGG   Cricetulus griseus (Chinese hamster): 100753184Help
Entry
100753184         CDS       T02813                                 

Gene name
Pgm1
Definition
(RefSeq) phosphoglucomutase-1 isoform X2
  KO
K01835  phosphoglucomutase [EC:5.4.2.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00052  Galactose metabolism
cge00230  Purine metabolism
cge00500  Starch and sucrose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
Module
cge_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
cge_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100753184 (Pgm1)
   00030 Pentose phosphate pathway
    100753184 (Pgm1)
   00052 Galactose metabolism
    100753184 (Pgm1)
   00500 Starch and sucrose metabolism
    100753184 (Pgm1)
   00520 Amino sugar and nucleotide sugar metabolism
    100753184 (Pgm1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100753184 (Pgm1)
Enzymes [BR:cge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     100753184 (Pgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 100753184
NCBI-ProteinID: XP_027256298
LinkDB All DBs
Position
2
AA seq 562 aa AA seqDB search
MVKIVTVKTQAYPDQKPGTSGLRKRVKVFQSNANYTENFIQSIVSTVEPALRQEATLVVG
GDGRFYMTEAIQLIVRIAAANGIGCLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNP
GGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLSVLGKQQFDLENK
FKPFTVEIVDSVEDYAAMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEE
LGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKH
GFFVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKVALYETPTGWK
FFGNLMDASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKF
GRNFFTRYDYEEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPV
DGSVSRNQGLRLIFADGSRIIFRLSGTGSAGATIRLYIDSYEKGAANINQDPQVMLAPLI
SIALKVSQLQERTGRTAPTVIT
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagatcgtgacagtgaagacgcaggcgtacccggaccagaagcctggtacgagc
gggctgcggaagcgggtgaaagtgttccagagtaacgccaactacacggagaatttcatc
cagagcatcgtctccacggtggagccggcgctgaggcaggaggccacactggtggtgggc
ggggacggccgcttctacatgaccgaggctatccagcttatcgtccgcatcgccgccgcc
aacgggattggctgcctggttattggacagaatggcatcctctccactcctgctgtgtcc
tgcatcatccgaaaaatcaaagccattggtgggatcattctgacggccagccacaaccca
ggagggcccaatggagattttgggattaaattcaatatttctaatgggggtcctgctcca
gaagcaatcactgataaaattttccaaatcagcaagacaattgaagaatatgccatttgc
cctgacttgaaggtagacctcagtgttctgggaaagcagcagtttgacctggaaaacaag
ttcaagcccttcacagtggagattgtagactcggtggaggactatgcggcaatgttgaga
aacatctttgattttaatgccctgaaggagctactgtctggtccaaacagactgaagatc
cgcatagatgccatgcatggagttgtgggaccgtacgtaaagaagatcctctgtgaagag
cttggtgcccctgcaaactcagcagtgaactgtgttcccctggaggactttggaggccac
caccctgaccccaacctcacctatgctgctgacctggtggagaccatgaagtcaggagag
catgattttggggctgcctttgatggtgatggggatcggaacatgattctgggcaagcat
gggttctttgtgaacccttccgactctgtggccgtcatcgctgccaacatcttcagcatt
ccgtatttccagcagactggggtccgtggctttgcacgcagtatgcccacaagtggagcc
ctggatcgggtagcaaacgccacaaaggtcgctttgtatgagaccccaactggctggaag
ttttttgggaacttgatggatgcaagcaaactgtccctttgtggggaggagagcttcggg
actggttccgaccacattcgtgagaaagatggactgtgggctgtcctggcctggctctcc
attctggccacccgaaagcagagcgtggaggacatcctcaaagaccactggcaaaagttt
ggccggaacttctttaccaggtatgattatgaggaggtggaagccgagggtgcaaacaaa
atgatgaaggacctggaagccctgatgttggaccgttcctttgtggggaagcagttctca
gcaaatgataaagtctacactgtggagaaggctgataactttgaatatagtgacccggta
gacggaagcgtttcaagaaatcagggcttgcggcttatttttgcagatggttctcgtatc
atcttcagactgagtggcaccgggagtgcaggggccaccattcggctgtatattgatagt
tatgagaagggcgctgccaacatcaatcaggacccccaggtcatgctggctcccctgatc
tccattgctctgaaggtgtcccagctccaggagaggacaggacgtactgcccccactgtc
atcacctag

KEGG   Cricetulus griseus (Chinese hamster): 100761029Help
Entry
100761029         CDS       T02813                                 

Gene name
Pgm2
Definition
(RefSeq) phosphoglucomutase-2
  KO
K15779  phosphoglucomutase / phosphopentomutase [EC:5.4.2.2 5.4.2.7]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00052  Galactose metabolism
cge00230  Purine metabolism
cge00500  Starch and sucrose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
Module
cge_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100761029 (Pgm2)
   00030 Pentose phosphate pathway
    100761029 (Pgm2)
   00052 Galactose metabolism
    100761029 (Pgm2)
   00500 Starch and sucrose metabolism
    100761029 (Pgm2)
   00520 Amino sugar and nucleotide sugar metabolism
    100761029 (Pgm2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100761029 (Pgm2)
Enzymes [BR:cge01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     100761029 (Pgm2)
    5.4.2.7  phosphopentomutase
     100761029 (Pgm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-GeneID: 100761029
NCBI-ProteinID: XP_027246522
UniProt: G3IFE7
LinkDB All DBs
Position
1
AA seq 620 aa AA seqDB search
MAEAMATPIPAPGVSGSGMDTRLEQETAQWLRWDRNPLTSESVKQLIAEGNNEELQKCFG
ARMEFGTAGLRAPMGAGISRMNDLTIIQTTQGFCRYLEKQFSDLKQRGVVISFDARAHPA
SGGSSRRFARLAATAFISQGVPVHLFSDITPTPFVPYTVSHLKLCAGIMITASHNPKQDN
GYKVYWDNGAQIISPHDRGISQAIEENLEPWPQAWDESLIDSSSLLHNPSTSISHDYFED
LKKYCFHRSVNRESDVKFVHTSVHGVGHEFVQLAFKAFDLAPPEAVPEQKDPDPEFPTVK
YPNPEEGKGVLTLSFALADKIKAKIILANDPDADRLAVAEKQDSGEWRVFSGNELGALLG
WWLFTSWKEKNRDRSTLKDTYMLSSTVSSKILRAIALKEGFHFEETLTGFKWMGNRTKQL
VDQGKTVLFAFEEAIGYMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLKAIYVEY
GYHITKASYFICHDQGTIQKLFGNLRNYDGKNNYPKTCGRFEISAIRDLTTGYDDSQPDK
KAILPTSKSSQMITFTFANGGVATIRTSGTEPKIKYYAELCAPPGNSDLEQLKKELDELV
SAIEENFFQPQKYNLQPKSE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcaatggcgacaccgataccagctccgggagtcagtggctccggcatggac
acgcgactggagcaggagaccgctcagtggctgcgctgggaccggaatcccttaacttca
gagtcagtgaaacagctcattgctgaaggtaataatgaagagctgcagaaatgctttggg
gcccggatggagtttgggacagctggccttcgagctcctatgggagctgggatttcgaga
atgaatgacttgaccatcatccagaccacacagggattttgcaggtacttggaaaagcag
ttcagtgacctgaagcagaggggcgtggtgatcagcttcgatgctagagctcatcctgcc
agtggaggcagcagcaggaggtttgcccggcttgctgcgactgcatttatcagccagggg
gttcctgtgcatctcttctctgatataacccccaccccatttgtgccctacacagtgtca
catctgaaactctgtgctgggatcatgatcactgcctcgcacaatccgaagcaggacaat
ggctataaggtctactgggacaatggagcacagatcatctctccacacgatcgaggcatt
tctcaagctatcgaagaaaatctggagccctggccgcaagcttgggatgagtctttgatt
gacagcagttcccttcttcacaaccccagcacttccatcagtcatgactactttgaagac
ctgaaaaaatactgttttcacaggagtgtgaacagggagagtgacgtgaagtttgtgcac
acctccgtccatggtgtgggccatgagtttgtgcagctggcattcaaggcctttgacctt
gctcctcctgaagctgttcccgaacagaaagatccggatcctgagtttccaactgtcaaa
tacccaaatcctgaggagggtaaaggtgtcttgactttatcctttgccttagctgacaaa
atcaaggccaaaattatcttagccaacgacccagatgcggacagacttgctgtggctgaa
aagcaagacagtggtgagtggagagtgttctcaggcaatgagctgggagccctgctggga
tggtggctcttcacttcctggaaagaaaagaaccgtgatcgaagtaccctcaaagacaca
tacatgttgtccagcactgtctcctccaagatcttgcgagccattgccttgaaggagggc
tttcattttgaggaaacattaactggcttcaaatggatgggaaacagaaccaaacagcta
gtagaccaggggaagacggtcctatttgcatttgaagaagctatcggatatatgtgctgt
ccctttgtgctggacaaggatggagtcagtgcagctgtcataagtgcagagctggcgagt
tttctagcaaccaagaatctgtctttgtctcagcagctgaaggccatctatgtggagtat
ggctatcatattaccaaagcttcatattttatctgccatgatcaagggaccattcaaaaa
ttatttggaaacctgagaaactatgatgggaagaataattatcccaaaacatgtggcaga
tttgaaatctctgctatcagggaccttacaactggctatgatgacagtcagcctgataaa
aaagctattcttcctaccagcaagagcagccaaatgatcacctttacctttgctaatgga
ggtgtggccaccattcggaccagtggaacagagcccaaaatcaagtactatgcagagctg
tgcgctccccctggcaacagtgatctggagcagctgaaaaaggaactagatgagctagtc
agtgccattgaagaaaactttttccagccacaaaagtataacctgcagccaaaatccgaa
taa

DBGET integrated database retrieval system