KEGG   Cricetulus griseus (Chinese hamster): 100753219Help
Entry
100753219         CDS       T02813                                 

Gene name
G6pc3
Definition
(RefSeq) glucose-6-phosphatase 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04068  FoxO signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04931  Insulin resistance
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100753219 (G6pc3)
   00052 Galactose metabolism
    100753219 (G6pc3)
   00500 Starch and sucrose metabolism
    100753219 (G6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100753219 (G6pc3)
   04151 PI3K-Akt signaling pathway
    100753219 (G6pc3)
   04152 AMPK signaling pathway
    100753219 (G6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100753219 (G6pc3)
   04922 Glucagon signaling pathway
    100753219 (G6pc3)
   04920 Adipocytokine signaling pathway
    100753219 (G6pc3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100753219 (G6pc3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100753219 (G6pc3)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100753219 (G6pc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100753219
NCBI-ProteinID: XP_027283749
LinkDB All DBs
Position
7
AA seq 346 aa AA seqDB search
MESMLSAGIAMAEALQKRLPGLENMWLWVTFLGDPKNLYMLFFPAAYYASRRLGICVLWI
TFITEWLNLVFKWFLFGDRPFWWVHESGYSSQTPVQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTAISSQVASRSRSPWVRVIPSLAYCTFLLAVGLSRVFLLAHFPHQVLAGLITGA
VLGWLMAPHVPMERELSFYGLTALALMLGASLMYWTLFTLGLDLSWSISLASKWCERPEW
VHLDSRPFASLSRVSGTALGLGIALHSPCYGQIRRAYLGNGQKIACFLLAIGLLVILEWL
GHPPQISLFYIFNFLKYTLWPCLVLALVPWLVHTFSVQEAPPIHSS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggagtccatgctgagcgcgggcatcgccatggctgaagcgctgcagaagcggctcccc
gggctagagaatatgtggctctgggtcacctttctaggcgatcccaagaacctctatatg
ttgttcttccccgcggcctactacgcctctcgccgactgggcatctgcgtgctctggatc
accttcattactgagtggctcaacctcgtcttcaagtggtttctgtttggagacaggccc
ttttggtgggtgcatgagtctgggtactccagccagactccagtccaggttcaccagttc
ccctcttcttgtgagactggcccaggcagcccttctggccattgcatgatcacgggagca
gctctctggcctataatgacagccatttcttctcaggtggcatctcggtcccgaagcccc
tgggtaagggtgattcctagcctggcttattgcaccttcttattggcagtcggcctatct
cgggtcttcctcttagcacatttccctcaccaggtgttggcaggccttataactggtgct
gtgcttggctggcttatggctccacatgtgcccatggaacgggaacttagcttctatggg
ttgactgctctggcccttatgctgggtgccagcctcatgtattggactctttttacactg
ggcctggatctttcctggtccatcagcctggcttccaagtggtgtgagcggcccgagtgg
gtgcatttggacagtcgaccctttgcctcactgagccgtgtctcgggaactgccctgggt
cttggcattgctttacactctccctgttatggccagatacggcgggcatacctgggaaac
ggccagaagatagcttgctttttgctggccattgggctgctggtcatcttggaatggctg
ggccacccacctcagatcagcctcttctacatcttcaacttcctcaaatacaccctctgg
ccctgcctggtcttggcccttgtgccctggctggtgcacacattcagtgtccaggaagca
ccacccattcactcctcttga

KEGG   Cricetulus griseus (Chinese hamster): 100762184Help
Entry
100762184         CDS       T02813                                 

Gene name
G6pc2
Definition
(RefSeq) glucose-6-phosphatase 2 isoform X1
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04068  FoxO signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04931  Insulin resistance
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100762184 (G6pc2)
   00052 Galactose metabolism
    100762184 (G6pc2)
   00500 Starch and sucrose metabolism
    100762184 (G6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100762184 (G6pc2)
   04151 PI3K-Akt signaling pathway
    100762184 (G6pc2)
   04152 AMPK signaling pathway
    100762184 (G6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100762184 (G6pc2)
   04922 Glucagon signaling pathway
    100762184 (G6pc2)
   04920 Adipocytokine signaling pathway
    100762184 (G6pc2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100762184 (G6pc2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100762184 (G6pc2)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100762184 (G6pc2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100762184
NCBI-ProteinID: XP_027275856
LinkDB All DBs
Position
6
AA seq 355 aa AA seqDB search
MDFLHRSRVLIIQHLQKDYRAYYNFLNFMSNVGDLRNIFSIYFPLWFQLNQTVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWIQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSYTVSRLDKSSVTLHRLTWSCLWSVFWLIQVSVCISRVFIATHFPHQVI
LGIIGGMLVAEAFEHTPGIHMANLNVYLKTNIFLFLFALGFYLLLRLLDIDLLWSVPIAK
KWCANPDWIHIDSTPFAGLVRNLGVLFGLGFAINSEMFLKSCQGENGDKLSFQLLCAITS
LATLQLYHFIKIPTHREPLFYLLSFCKSASIPLTVVALIPYCVHMFMRASEKKTK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggatttccttcataggagcagagtactgatcattcaacatctacagaaagactatagg
gcctactacaattttctaaattttatgtccaatgttggagacctccggaatatcttttct
atttactttccactttggtttcaactgaatcagactgttgggaccaagatgatatgggta
gcagtcataggagactggttcaaccttatattcaaatggatattatttgggcatcgtcct
tactggtggatccaagaaactcagatttacccaaatcactcaagcccatgtcttgaacag
tttcctactacatgtgaaacaggcccaggaagtccatctggtcatgcaatgggctcatca
tgtgtctggtatgtcatggtaaccgctgccctcagctacactgtcagcaggctggataag
tcctctgtcactctgcacagactgacctggtcctgcctttggagtgttttctggttgatt
caagtcagtgtctgcatctccagagtattcatagcaacacatttcccccatcaggttatc
ctcggaatcattggtgggatgctagtagcagaggcctttgaacatactccaggaatccac
atggccaacttgaatgtgtacctgaagaccaacatcttcctcttcctatttgcacttggc
ttttacctgcttctcaggctgcttgacattgacctgctgtggtctgtgcccatagccaaa
aagtggtgtgccaacccagactggatccacattgacagcacgccttttgctggacttgtg
agaaaccttggagtcctctttggcttgggttttgccatcaactcagaaatgttccttaag
agctgccagggagaaaatggcgacaagctgagcttccagttgctctgtgccatcacctca
ctggccacattgcaactctatcacttcatcaagatcccgactcacagggaacctttattt
tacctcttgtctttttgtaaaagtgcatccatcccgctgactgtggtggctctgattcct
tactgtgtccatatgtttatgagagccagtgagaaaaagactaaatag

KEGG   Cricetulus griseus (Chinese hamster): 100763214Help
Entry
100763214         CDS       T02813                                 

Gene name
G6pc
Definition
(RefSeq) glucose-6-phosphatase
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04068  FoxO signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04922  Glucagon signaling pathway
cge04931  Insulin resistance
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100763214 (G6pc)
   00052 Galactose metabolism
    100763214 (G6pc)
   00500 Starch and sucrose metabolism
    100763214 (G6pc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100763214 (G6pc)
   04151 PI3K-Akt signaling pathway
    100763214 (G6pc)
   04152 AMPK signaling pathway
    100763214 (G6pc)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100763214 (G6pc)
   04922 Glucagon signaling pathway
    100763214 (G6pc)
   04920 Adipocytokine signaling pathway
    100763214 (G6pc)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100763214 (G6pc)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100763214 (G6pc)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100763214 (G6pc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAP2
Motif
Other DBs
NCBI-GeneID: 100763214
NCBI-ProteinID: XP_027283872
LinkDB All DBs
Position
7
AA seq 357 aa AA seqDB search
MEEGMNALHDFGIQSTRYLQVNYEDSQDWFILVSVIADLRNAFYILFPIWFHLQETVGIK
LLWVAVIGDWINLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGAAGVYYVMVTSTLSIFRGKKKPTYGFRCLKLILWLGYWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIRGIYNASLKKYFLITVFLFGFALGFYLLLKELGVDLLWTLEK
AKRWCERPEWVHLDTTPFASLFKNLGTLFGLGLALNSSMYRESCKGELGKSLPFRLACIV
PSLVLLHLFDTLKPPSQVELVFYALSFCKSATVPFASVSLIPYCLARALGQTHKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaggaatgaacgccctccacgactttgggatccagtccacccgctacctccaa
gtgaattacgaagactcgcaggactggttcatcttagtgtctgtgatcgctgacctcagg
aatgccttctacatcctcttccccatctggttccatcttcaagagactgtgggcatcaaa
ctcctttgggtggcagtgattggggactggatcaacctcgtctttaagtggattcttttt
ggacagcggccatactggtgggtcctggacacggactactacagcaacacctcggtgccc
ctgataaaacagttccctgtcacctgtgaaactggaccagggagtccttctggccatgcc
atgggtgcagctggtgtatactacgtaatggtcacctctaccctctctatctttcgtgga
aagaaaaagccaacatatggattccggtgtttgaaactcatcttgtggttgggatactgg
gcggtgcaactgaacgtctgtctgtcccggatctacctcgcggctcactttccccaccag
gttgtggctggagtcttgtcaggtattgctgtggctgaaactttcagccacatccggggc
atctacaatgctagcctcaagaagtattttctcatcactgtcttcctctttggtttcgcc
cttggattttacctgctgctaaaagagctgggggtggacctgctatggactttggagaaa
gccaagagatggtgtgagcggccggaatgggtccacctcgacaccacaccctttgccagc
ctctttaaaaacctgggaaccctctttgggttggggctggccctcaactccagcatgtac
cgggagagctgcaagggagaactcggcaagtcactcccgttccgccttgcctgcattgtg
ccctccttggtcctcctgcacctctttgacactttgaaacccccatcccaggttgaactg
gttttctacgctttgtctttctgcaagagtgcgacggttccgtttgcatctgtcagtctt
atcccctactgtctagcccgggctctgggccagacacacaagaagtctttgtaa

DBGET integrated database retrieval system