KEGG   Cricetulus griseus (Chinese hamster): 100753358
Entry
100753358         CDS       T02813                                 

Gene name
Ccne1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X2
  KO
K06626  G1/S-specific cyclin-E1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04114  Oocyte meiosis
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05161  Hepatitis B
cge05162  Measles
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05215  Prostate cancer
cge05222  Small cell lung cancer
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100753358 (Ccne1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100753358 (Ccne1)
   04114 Oocyte meiosis
    100753358 (Ccne1)
   04115 p53 signaling pathway
    100753358 (Ccne1)
   04218 Cellular senescence
    100753358 (Ccne1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100753358 (Ccne1)
   05206 MicroRNAs in cancer
    100753358 (Ccne1)
   05203 Viral carcinogenesis
    100753358 (Ccne1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100753358 (Ccne1)
   05215 Prostate cancer
    100753358 (Ccne1)
   05222 Small cell lung cancer
    100753358 (Ccne1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100753358 (Ccne1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100753358 (Ccne1)
   05161 Hepatitis B
    100753358 (Ccne1)
   05162 Measles
    100753358 (Ccne1)
   05169 Epstein-Barr virus infection
    100753358 (Ccne1)
   05165 Human papillomavirus infection
    100753358 (Ccne1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100753358 (Ccne1)
   03036 Chromosome and associated proteins [BR:cge03036]
    100753358 (Ccne1)
DNA replication proteins [BR:cge03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100753358 (Ccne1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100753358 (Ccne1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100753358
NCBI-ProteinID: XP_027286107
UniProt: G3I4C1
LinkDB
Position
9
AA seq 412 aa
MPRERKERDAQDHGGIREEGGPDSSVRSRKRKANVAVFLQDPDEEIARVDKTVKSQDSSQ
QPWDDNSACVDPCAFIPTPNKEEDDELEYPKTAFQPRKIRPPRASPLPVLNWGNREEVWR
IMLNKEKIYLRDEHFLQRHPLLQARMRAVLLDWLMEVCEVYKLHRETFYLAQDFFDRYMA
SQQNILKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILQMELMMMKALK
WRLSPMTIVSWLNVYVQVAYVNDTSEVLLPQYPQQVFVQIAELLDLCVLDVGCLEFPYGV
LAASALYHFSSMELMQKVSGYQWCDIEKCVKWMVPFAMAFREVGSSKLKHFRGVPMENAH
NIQTHANSLDLLDKAQAKKAILSEQNRISPPPSGVLTPPPSSKKQNSEEETE
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgccacgggagaggaaggagagagatgcccaggaccacggcggcatcagggaagaaggt
ggccctgactcctcggtgcgctccaggaaaaggaaggcgaatgtggccgtttttttgcaa
gatccagatgaagaaatcgccagagttgacaagactgtgaaaagccaggatagcagtcag
cagccttgggatgataattcagcctgtgtggacccatgcgctttcatccccacccctaat
aaagaagaggacgatgagcttgagtaccccaagactgcgtttcagcctcggaaaatcagg
ccacccagggcctccccgcttccagtcttgaactggggcaatagagaagaggtttggagg
atcatgttaaacaaggagaagatttacctaagagatgagcactttctgcaacgccatcct
ctcctgcaggcaaggatgcgagcagttcttctggattggctaatggaggtgtgcgaagtc
tataagcttcacagggagacattctatctggcgcaagacttctttgatcgttacatggca
tcacaacaaaatatactgaaaacacttttacagctcattgggatttcagctttatttatt
gcttctaaacttgaggaaatctaccctccaaagttgcaccagtttgcttacgttacagat
ggcgcttgttccggagatgaaattctccagatggaattaatgatgatgaaggcccttaag
tggcgtttaagcccaatgaccattgtgtcctggctgaacgtgtatgtccaagtggcttat
gtcaatgacacaagcgaggtgctactgcctcagtacccacagcaggtctttgtgcagatt
gctgagcttttagatctgtgtgtcctggatgtcggctgcttagaatttccttatggtgtc
cttgctgcttctgccttgtatcatttctcctccatggaactgatgcagaaggtttcaggg
tatcagtggtgcgacatagagaaatgtgtcaagtggatggttccgttcgccatggccttc
cgggaggtgggaagctccaagctcaagcacttccggggagttcccatggaaaacgcccac
aacatccagacccacgccaacagcttggatttgctggacaaagcccaggcaaagaaagcc
atattgtcagaacagaacaggatctctcctcctcccagtggggtcctgacacccccaccc
agcagtaagaagcagaacagtgaggaggagacagaatga

KEGG   Cricetulus griseus (Chinese hamster): 100760464
Entry
100760464         CDS       T02813                                 

Gene name
Ccne2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X3
  KO
K06626  G1/S-specific cyclin-E1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04114  Oocyte meiosis
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05161  Hepatitis B
cge05162  Measles
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05215  Prostate cancer
cge05222  Small cell lung cancer
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100760464 (Ccne2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100760464 (Ccne2)
   04114 Oocyte meiosis
    100760464 (Ccne2)
   04115 p53 signaling pathway
    100760464 (Ccne2)
   04218 Cellular senescence
    100760464 (Ccne2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760464 (Ccne2)
   05206 MicroRNAs in cancer
    100760464 (Ccne2)
   05203 Viral carcinogenesis
    100760464 (Ccne2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100760464 (Ccne2)
   05215 Prostate cancer
    100760464 (Ccne2)
   05222 Small cell lung cancer
    100760464 (Ccne2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100760464 (Ccne2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100760464 (Ccne2)
   05161 Hepatitis B
    100760464 (Ccne2)
   05162 Measles
    100760464 (Ccne2)
   05169 Epstein-Barr virus infection
    100760464 (Ccne2)
   05165 Human papillomavirus infection
    100760464 (Ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100760464 (Ccne2)
   03036 Chromosome and associated proteins [BR:cge03036]
    100760464 (Ccne2)
DNA replication proteins [BR:cge03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100760464 (Ccne2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100760464 (Ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100760464
NCBI-ProteinID: XP_027259302
LinkDB
Position
2
AA seq 405 aa
MSRRSSRLQAKQQHAQPNQPDSPQEVQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWP
PVLSGGISPCIIIETPHKEIETSDFSRFTNYRFKNLFINPSPLPDLSWGCSQEVWLNMLQ
KESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
VNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELSILKALKWELC
PVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAA
ALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQT
HTNYLALLNEVNYVNTFRKGGQLSPVCNGGIMTPPKSTEKPPLKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcgagacgcagtagccgtttacaagctaagcagcagcatgcccagcccaaccagcca
gactctccgcaagaagtccagataattcaggccaagaagagaaaaacagcacaggatgtc
aaaaaaagaaaagaggagatcaccaagaagcatcagtatgagatcaggaattgttggcca
cctgtactgtctggaggaatcagtccttgcattatcattgaaacgccccataaagaaata
gaaacaagtgacttctctagatttacaaattacagatttaaaaatctttttattaatcct
tcacctctgccagatttaagctgggggtgttcacaggaggtttggctaaacatgctacaa
aaggagagcagatacgtgcatgacaaacattttgaagttctgcattctgacctggaacca
cagatgaggtcaatacttttagactggcttttagaggtttgtgaagtatacacacttcat
agggagacattttaccttgcccaagacttttttgacagatttatgttgacacagaaagat
gtaaataaaaatatgcttcaactcattgggattacctcattgttcattgcttctaaactt
gaggaaatctacgctcccaaactccaagagtttgcttatgtcactgatggtgcttgcagt
gaagtagatatcttaaagatggaactctctatattaaaggctttaaaatgggaactttgt
cctgtaacagtcatttcctggttgaatctttttctccaagttgatgctgttaaagatgtt
cctaaggttcttctacctcaatattctcaggagacattcatccagatagctcagctttta
gatctgtgtatcctcgccattgactcattagaattccaatacagaattctggcagctgct
gctttgtgccattttacctccattgaagtagttaagaaagcctcaggtttggaatgggat
gacatttcagaatgtgtagactggatggtgccttttgtcagtgtagtaaaaagtgtaagt
ccagtgaagctgaagacttttaagaagatacccatggaagacagacataatatccagaca
cacacgaattatttggctttgctgaatgaagtaaactacgtgaacaccttcagaaaagga
gggcagttgtcaccagtgtgtaatggaggcatcatgacaccaccgaagagtactgagaaa
ccaccattaaaacactga

DBGET integrated database retrieval system