KEGG   Cricetulus griseus (Chinese hamster): 100753960
Entry
100753960         CDS       T02813                                 

Gene name
Epo
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
cge04066  HIF-1 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04630  JAK-STAT signaling pathway
cge04640  Hematopoietic cell lineage
cge05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100753960 (Epo)
   04066 HIF-1 signaling pathway
    100753960 (Epo)
   04151 PI3K-Akt signaling pathway
    100753960 (Epo)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100753960 (Epo)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100753960 (Epo)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100753960 (Epo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100753960 (Epo)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  CSF and other factors
   100753960 (Epo)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100753960
NCBI-ProteinID: XP_035300414
LinkDB
Position
4
AA seq 192 aa
MGVPERPTLPLLLSLLLLPLGLPVLCAPPRLICDSRVLERYILEAKEAENVTMGCAEGPR
LSENITVPDTKVNFYAWKRKAVEEQAVEVWHGLSLLSEAILRGQALLGNSSQPSEMLQLH
IDKAISGLRSLTSLLRVLGAQKESILPPDATPPAPLRTLSVDTFCKLFRVYSNFLRGKLK
LYTGEACRRGAR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcccgaacgtcccaccctgccgcttttgctgtctttgctcttgcttcctctg
ggcctcccagtcctctgcgctcccccacgcctcatctgcgacagccgagttctggagagg
tacatcttggaggccaaggaggcagagaacgtcacgatgggctgtgcagaaggtcccaga
ctgagtgagaatattacagtcccagataccaaagtcaacttctatgcttggaaaagaaag
gcggtggaagaacaggctgtagaagtttggcatggcctgtccctgctctccgaggccatc
ctgaggggccaggccctgctaggcaactcctcccaaccatcagagatgcttcagctgcat
atagacaaagccatcagtggcctgcgcagcctcacctccctgctccgggtgctgggagcc
cagaaggaatcgatattacctccagatgctaccccacctgctccactccgaacactctcg
gtggatactttctgcaaactcttccgggtctactccaactttctccggggcaaactgaag
ttgtacacaggggaggcctgcaggagaggggccaggtga

DBGET integrated database retrieval system