KEGG   Cricetulus griseus (Chinese hamster): 100754153
Entry
100754153         CDS       T02813                                 

Gene name
Nfkbia
Definition
(RefSeq) NF-kappa-B inhibitor alpha isoform X2
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04926  Relaxin signaling pathway
cge04931  Insulin resistance
cge05132  Salmonella infection
cge05134  Legionellosis
cge05135  Yersinia infection
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05171  Coronavirus disease - COVID-19
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100754153 (Nfkbia)
   04668 TNF signaling pathway
    100754153 (Nfkbia)
   04024 cAMP signaling pathway
    100754153 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100754153 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100754153 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    100754153 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    100754153 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    100754153 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    100754153 (Nfkbia)
   04660 T cell receptor signaling pathway
    100754153 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    100754153 (Nfkbia)
   04659 Th17 cell differentiation
    100754153 (Nfkbia)
   04657 IL-17 signaling pathway
    100754153 (Nfkbia)
   04662 B cell receptor signaling pathway
    100754153 (Nfkbia)
   04062 Chemokine signaling pathway
    100754153 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100754153 (Nfkbia)
   04926 Relaxin signaling pathway
    100754153 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100754153 (Nfkbia)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100754153 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754153 (Nfkbia)
   05203 Viral carcinogenesis
    100754153 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100754153 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100754153 (Nfkbia)
   05215 Prostate cancer
    100754153 (Nfkbia)
   05222 Small cell lung cancer
    100754153 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100754153 (Nfkbia)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100754153 (Nfkbia)
   05135 Yersinia infection
    100754153 (Nfkbia)
   05134 Legionellosis
    100754153 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754153 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    100754153 (Nfkbia)
   05161 Hepatitis B
    100754153 (Nfkbia)
   05160 Hepatitis C
    100754153 (Nfkbia)
   05171 Coronavirus disease - COVID-19
    100754153 (Nfkbia)
   05164 Influenza A
    100754153 (Nfkbia)
   05162 Measles
    100754153 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    100754153 (Nfkbia)
   05163 Human cytomegalovirus infection
    100754153 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100754153 (Nfkbia)
   05169 Epstein-Barr virus infection
    100754153 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100754153 (Nfkbia)
   05140 Leishmaniasis
    100754153 (Nfkbia)
   05142 Chagas disease
    100754153 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100754153 (Nfkbia)
   04131 Membrane trafficking [BR:cge04131]
    100754153 (Nfkbia)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100754153 (Nfkbia)
Membrane trafficking [BR:cge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100754153 (Nfkbia)
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100754153
NCBI-ProteinID: XP_027275491
LinkDB
Position
5
AA seq 314 aa
MFQPAGHGQDWAMEGPRDALKKERLVDDRHDSGLDSMKDEEYEQMVKELQEIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKTLTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQTCTPQHLHSILQATN
YNGHTCLHLASIHGYLGIVEHLVSLGADVNAQEPCNGRTALHLAVDLQNPELVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTRENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt   +upstreamnt  +downstreamnt
atgtttcagccagccggccacggccaggactgggccatggagggcccgcgggacgctctc
aagaaggagcggctggtggacgatcgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtgaaggagctgcaggagatccgcctgcagccgcaggaggcgccg
ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gcaatcatccatgaagagaagactctgaccatggaagtgattcggcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccacttcacttggctgtgatc
accaaccagccaggaattgctgaggcacttttggaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta
ggagtcctgacacagacgtgcacacctcagcatctccactccatcctgcaggccaccaac
tacaatggccacacgtgtctgcacctcgcctccatccatggctacctgggcatcgtggag
catttggtgtctttgggtgccgatgtcaatgcccaggagccctgcaatggccggacagcc
ctccacctggcagtggacctgcagaaccctgaactggtgtcgctcctgttgaagtgtggt
gctgacgtcaatagagtgacctaccaaggctactccccctatcagctcacctggggccga
ccaagtacccggatacagcagcagctgggccagctgacccgggaaaatcttcagatgctg
cccgagagtgaggatgaggagagctacgacacagagtcagaattcacggaggatgagctg
ccctatgatgactgtgtatttggaggccaacgtctgacattatga

DBGET integrated database retrieval system