KEGG   Cricetulus griseus (Chinese hamster): 100754226
Entry
100754226         CDS       T02813                                 

Definition
(RefSeq) serine-protein kinase ATM isoform X6
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01524  Platinum drug resistance
cge03440  Homologous recombination
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05170  Human immunodeficiency virus 1 infection
cge05202  Transcriptional misregulation in cancer
cge05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100754226
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100754226
   04068 FoxO signaling pathway
    100754226
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100754226
   04210 Apoptosis
    100754226
   04115 p53 signaling pathway
    100754226
   04218 Cellular senescence
    100754226
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100754226
   05206 MicroRNAs in cancer
    100754226
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754226
   05170 Human immunodeficiency virus 1 infection
    100754226
   05165 Human papillomavirus infection
    100754226
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100754226
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100754226
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100754226
   03400 DNA repair and recombination proteins [BR:cge03400]
    100754226
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100754226
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100754226
DNA replication proteins [BR:cge03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100754226
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100754226
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC
Other DBs
NCBI-GeneID: 100754226
NCBI-ProteinID: XP_027270889
LinkDB
Position
4
AA seq 3061 aa
MSLALNDLLVCCRQLEHDRATERRKEVERFKRLIQDPETVQHLDRHSDSKQQKYLNWDAV
FRFLQNYINKETECLKTAKPNVSASTQTSRQKKMQEISSLVRYFIKCANKRAPRLKCQDL
LNYVMDTVKDSSNGVTYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPPQ
DINRVLVARIIHAVTGGCCSQTDGLPSKFLDFFSKAVQYARQEKSSPGLSHILSALVIFL
KTLAVNFRKRVCEVGDEILPTLLCIWTQHRLNDSLKEVIIELIQLQIYIHHPQGAKTPEK
GAYESTKWKSFLYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIDLMADLCHQLFNAD
TRSVEISQSFTTQRESTDYSMPCKKRKIEVGWEVIKDHLQKSQNDFDLVPWLQITTQLIS
KYPSSLPNCDLSPLLLILYQLLPQQRRGERTPYVLRCLMEVALCQGKKSNLESPQKSDLA
KLWIKIWSIAFRGISSEHTQTENFGLLGAIIQGSLIEFDREFWKLFTGSACKPSSPSVCC
LTLALNICVVPDTMKMGTEQNMCEVNRSFSVKESIMRWLLFYQLEDDLEVSKEPPPILQS
NFPHLVLEKILVSLTMKNSRAAMKFFQSVPDCEQHCQDKEEPSFSEVEELFLQTTFDKMD
FLTTVKECTVEKSHSSVGFSVHQNLKESLDHYLLELSEQLLNNYSSEITSPETLVRCSSL
LVGVLGCYCFVGIIMEEEAYKSELFQKAKSLMQCAGESISLFKNKTNEESRIGSLRNVIH
LCTSCLCRHTKHNPHKMVSSFFLRLLTSKLMNDIADICRSLASCMKKPFDYREVHSVKED
ADENLMEAQGPSSTSLFSDYPASTLNDANDSGENQSTVGAMNPLTADYLSKQDHLLLDML
RFLCLCVTASQNNTVSFRAADIRRKLLMLLDSSTLDLTKSLHLHMYLGLLKDLPGREHSL
PMEDVDELLKPLSLACSLHRRDQDVCKTILSHVLHIVTNLSQGSVDTESTRNAQGQFLTV
IGAFWHLTKEKKCIFSVRMALVKCLQTLLEADPYSKWTTLNVKGQDFPVNEVFPQFLADD
HHQVRMLAAGSINRLFQDVKHGDSSRCLKALPLKFQQTAFKNAYMKAEAAIREVSCDTQN
PDLLDEIHNRKSVLLMVIAVILHCSPVCEKQALFALCKSVKENGLEPHLVKKVLEKVSES
FGSRCLEDFMASHLDYLVLEWLNLQDTGYNLSSFPFILLNYTSIEDFYRSCYKVLIPHLV
IRSQFDEVKSIANQIQKCWKSLLIDCFPKILVHILPYFAYEGTGDSSITQKREIATMVYD
TLKGEDLLGKQIDQVFISNLPEIVVELLMTLHETADSDASQSTDLSDFSGDLDPAPNPPY
FPSHVIKATFAYISNCHKTKFKSILEILSKIPDSYQKILLAICEQAAETNNVYKKHRILK
IYHLFVSLLLKDMKSGLGGAWAFVLRDVIYTLIHYINKRPSHFTDVSLRSFSLCCDLLSR
VCHTAVTHCKDALENHLHVIVGTLIPLVDYQEVQEQVLDLLKYLVIENKDNENLFVMIKL
LDPFPDHAVFKNLRLTQQKIKYSGGPFSLLEEINHFLSVSAYNPLPLTRLEGLKDLRRQL
EQHKDQMLALMRASQDNPQDGIVVKLVVSLLQLSKMAVNQTGEREVLEAVGRCLGEIGPL
DFSTIAVQHKKDTSYTEAHGLPEDKELQWTLIMLTTLNNTLVENSVKIRSAAATCLKNIL
ATKTGHSFWETYKMSEDPMLTYLQPFRTSRKKFLEVPRFVKEDAFEGLDDVNLWVPQSES
HDIWIKALTCAFLDSGGIKSEVLQLLKPMCEVKPDFCQTVLPYLIHDVLLQNTHESWRTL
LSTHVRGFFTSCFKHFSQASRSATPANSDSEPEHFLRCCLDKNSQRTMLAVVDYMRRQKR
PSSGTAFDDAFWLDLNYLEVAKVAQSCAAHFTALLYVEIYSDKKSMDEQEKRDVLMVNRS
PTFEEGSQGTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTRIR
TYEHEAMWGKALVTYDLETTISSSTRQSGIIQALQNLGLSHILSIYLKGLDHENREWCAE
LQELYYQAAWRNMQWDLCSSANQELEGASYHESLYNALQSLRNNEFSTFYESLRYARVKE
VEELCKGSLESVYSLYPILSRLQALGELENMGELFSRSVTDRDCSEVYLKWQKHSQLLKD
SDFSFQEPLMALRTVILEILVQKEMENSQGGCSKDMLTKHLVEFSVLARTFKNTQLPERA
IFKIKQYNSAICGVSEWHLEEAQVFWAKKEQSLALNILKQMIKKLDSSFKENDAGLKVIY
AECLRVCGNWLAETCLENPAVIMQTYLEKAVKVAGSYDGKSSELRNGQMKAFLSLARFSD
TQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDECALRAL
KEDRKRFLCKAVENYISCLLSGEEQDMWVFRLCSLWLENSGVPEVNGMMKRDGMKISSYK
FLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDELLSKP
EAARRSRITKNAPKESSQLDEDRTEAATKIIHTIRRERCKMVKDMEALCDAYIILANLDA
SQWRSQRKGINIPTNQPITKLKNLEDVVVPTMEIKVDPTGEYENLVTIKSFKTEFRLAGG
LNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTY
KVVPLSQRSGVLEWCTGTIPIGEYLVNNEEGAHKRYRPNDFSAFQCQKKMMEVQKKSFEE
KYDTFMTICQNFEPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRHVQN
ILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLSRDIVDGMGITGVEGVFRRCCEKTM
EVMRSSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETDLHSTPNAEDQECKRSL
SDIDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGWKAW
V
NT seq 9186 nt   +upstreamnt  +downstreamnt
atgagtctagcacttaacgatctgcttgtttgctgccggcaattagaacacgacagagct
acagaaagaaggaaagaagtggagagatttaagcgtctgattcaggaccctgaaacagtt
caacatctagataggcattcagattccaaacaacaaaaatatttgaattgggatgctgtt
ttcaggtttctgcagaattatattaacaaagaaacagaatgtctgaaaacagcaaaacca
aatgtatcagcctccacacaaacctccagacagaagaagatgcaagagatcagcagtttg
gtcagatacttcatcaaatgtgcaaataagagagctcccaggctaaaatgtcaagacctc
ttgaattatgtcatggatacagtgaaagattcatctaatggtgtaacttatggagctgat
tgtagcaacatactactcaaagatattctttctgtgagaaaatactggtgtgaaatatct
cagcaacagtggctagaattgttctctgtgtacttcaggctgtatctcaaaccaccacaa
gacatcaatagagttttagtggctagaataattcatgctgtcactggaggatgttgttca
cagactgatggattaccttcaaagtttttggattttttttccaaggctgttcagtatgca
agacaagaaaagagctctcctggcttaagtcatatcttatcagcccttgtcattttcctc
aagactttggctgtcaacttccgaaaacgggtgtgtgaagtaggagatgaaattcttcct
accttactgtgtatttggactcaacacagacttaatgattctttaaaagaagtaatcatt
gaactaattcaactgcaaatttatatccatcatccacaaggagccaaaacccctgaaaaa
ggtgcttacgaatcaacaaaatggaaaagtttcttgtacaacttatatgacctgctggtg
aatgagattagtcatataggaagtagagggaaatactcttcaggatctcgtaatattgct
gtcaaggaaaatttgattgacttaatggcagatctctgtcaccagctttttaatgcagat
accagatctgtggagatttctcagtcttttactacacaaagagaatctactgattacagt
atgccttgcaaaaaaaggaaaatagaagtaggctgggaagtgataaaagatcatcttcag
aagtcacagaatgattttgatcttgtgccttggctacagattacaacccaattaatatca
aagtatccctccagtttacctaactgtgatctgtctccattactattgatactgtaccag
cttctacctcaacaacgtcgcggagaacgcacaccatatgtgttacgatgccttatggaa
gttgccttatgtcaaggcaagaaatcaaacctagaaagccctcaaaagtcagacttagcg
aaactgtggattaaaatttggtctattgcctttcgtggtattagttctgaacatacacaa
actgaaaactttggtttacttggggccattattcaaggcagtttaattgaatttgacaga
gaattctggaagttatttactggctcagcctgtaaaccttcaagtccttcggtatgctgt
ttgactttggcacttaacatctgtgtagttccggatacaatgaaaatgggaacagagcaa
aatatgtgtgaagtgaatagaagtttctctgtaaaggagtcaataatgagatggctctta
ttctaccagttagaggatgacttagaagtcagcaaagaaccacctccaattcttcagagt
aattttcctcatcttgtactggagaaaattcttgtaagtctcactatgaaaaattctaga
gctgcaatgaagttttttcaaagtgtgccagattgtgaacaacactgccaagataaagaa
gagccttcattttcagaagtagaagaactatttcttcagacaacttttgacaagatggat
tttttaaccactgtgaaagaatgtactgtagaaaaatctcactcttctgttggcttttct
gtccaccaaaatctcaaggaatcattggatcattatcttctggaattatcagaacagctt
ctaaataattattcttctgagattacaagcccagaaacacttgtccgatgttcaagtctt
ttggtgggcgttcttggctgctactgttttgtgggtataataatggaagaggaagcatat
aaatcagaattgttccagaaagccaagtctctaatgcaatgtgcaggagaaagtatctct
ctatttaaaaataagacaaatgaggaatctagaattggttcattgagaaatgtgatacat
ctatgtacaagttgcttatgtagacataccaagcataatccacacaagatggtatccagc
tttttccttcgattgttaacatcaaagcttatgaatgacattgcagatatttgtagaagt
ttagcatcctgtatgaaaaagccatttgattatagagaagtccactcagtgaaagaggat
gctgatgaaaatctgatggaggcacagggtccatcatccacaagtctgtttagtgattac
cctgctagtactttgaatgatgcaaatgattctggagagaaccagagtactgttggtgcc
atgaatcctttaactgctgactacctgtcaaagcaagatcatcttcttttagacatgctc
aggttcttgtgcctatgtgtaactgcatctcagaacaatactgtgtcttttagagcagct
gatattagaagaaagttgttaatgctacttgattctagcacactagatcttactaaatcc
ctccatctacatatgtacttaggtcttctgaaggatctccctggaagagaacattcattg
ccaatggaagatgttgatgaacttctaaaaccattatcccttgcatgttctctgcatcgt
cgtgaccaagatgtttgtaaaacaattttaagccatgtccttcatatagtgacaaaccta
agtcagggcagtgtagacactgagagcacaaggaatgctcaaggacagttcctgacagtg
attggagcattttggcatctaacaaaggagaagaaatgtatattctctgtaagaatggca
ttagtaaagtgtcttcaaactctacttgaggccgatccatattccaaatggacgactctt
aatgtaaagggccaagactttcctgtaaatgaagtatttccacagtttcttgctgatgat
catcaccaagttcggatgttggctgcagggtcaatcaatagattattccaggatgtgaaa
catggagattcttccagatgcttgaaagcactacctttgaagtttcagcaaacagctttt
aaaaatgcatacatgaaagcagaggcagccataagagaagtgtcgtgtgatactcagaac
cctgatcttctggatgagattcataatagaaaatctgttttactgatggtgatagctgtg
atcttgcactgtagccctgtctgtgaaaaacaggctctgtttgccttatgcaaatctgtg
aaggaaaatggattagaacctcatcttgtcaaaaaggttttagagaaagtctctgaatct
tttgggagtagatgtttagaagacttcatggcttctcatctagattacctggttttggag
tggctgaaccttcaagatactggatacaacttatcttcctttccttttattttattaaac
tacacaagtattgaggatttctataggtcttgttacaaggttttgattccacatttggtg
attagaagtcaatttgatgaggtgaagtccattgctaatcagattcaaaagtgttggaaa
agtctgttgatagactgctttccaaagattcttgtgcatattcttccttacttcgcctat
gagggcacaggagacagcagcataacacagaagagagagattgctaccatggtctatgat
acacttaaaggcgaagacttactaggaaaacagattgatcaagtattcattagtaattta
ccagagattgtggtggagttattgatgacattacatgaaacagctgattctgatgccagt
caaagcactgacctcagtgacttttcaggggatttggatcctgctcctaatccaccatat
tttccatcccatgttattaaagcaacatttgcctatatcagtaactgtcataaaaccaag
ttcaaaagcattttagaaattctttctaaaatccctgattcctatcagaaaattcttctg
gccatttgtgaacaagcagctgagacaaataatgtctataaaaagcacagaattcttaaa
atatatcacctgtttgttagtttattactgaaagatatgaaaagtggcttgggaggagct
tgggcttttgttcttcgagatgttatttatactttgatacactatatcaacaaaaggcct
tctcatttcacagatgtatcattgcggagcttttccctttgttgtgatctgttaagtcga
gtatgccatacagctgtaactcactgtaaggatgctctagaaaaccatcttcatgttatt
gttggcacacttataccgcttgtggattatcaggaggttcaagaacaggtattggacctg
ttgaaatacttggtaatagagaataaggacaatgaaaatctctttgtcatgattaaactt
ttggatccttttcctgaccatgctgtttttaagaatttgcggcttactcaacagaaaatc
aaatatagtggaggaccattttcacttttagaggaaattaaccattttctttcagtaagt
gcttacaatccacttccactgaccaggcttgaaggactgaaggatcttcgaagacaactg
gaacaacataaagatcagatgcttgctcttatgagagcatctcaggataacccacaggat
ggtattgtggtgaagctggttgtcagcttattgcagttatccaagatggcagtgaaccag
actggtgaaagagaagttttagaggctgttggaaggtgtttgggagaaataggtcctctg
gatttctctactatagctgtacagcataagaaagatacatcttatacggaagctcatggg
ttacctgaagataaagaacttcagtggaccttgataatgctgaccaccctgaacaataca
ctggtagaaaacagtgtcaaaattcgatcagctgctgctacctgtttgaaaaacattttg
gctacaaagactggacacagtttctgggagacttataagatgtctgaggatcccatgctg
acctatctacaaccttttagaacatcaaggaaaaagtttttagaagtaccccgatttgtt
aaagaagatgcctttgaaggcctggatgatgtgaatctgtgggtccctcaaagtgaaagt
catgacatttggataaaggcactgacatgtgcctttttggacagtggaggcataaaaagt
gaagttcttcagttattaaagccaatgtgtgaggtgaaacctgacttctgtcagactgtg
ctgccatatttgatccatgatgtcctactccaaaatacacatgaatcatggagaactctg
ctgtctacacatgtccgaggatttttcactagctgttttaaacacttttcacaggcaagc
cgatcagcaactcctgcaaattcagattcagagccagagcacttcctcagatgctgtttg
gataaaaattcacaaagaacaatgcttgctgttgtcgactatatgagaaggcagaagagg
ccttcttcaggaacagcttttgatgatgctttctggctggatttgaattatctggaggtt
gcaaaggtggctcagtcttgtgctgctcacttcacggcattgctctacgtagagatctac
tcagataagaaaagcatggatgagcaagagaaaagagatgttcttatggtaaacagaagt
ccaacatttgaagaaggaagtcaaggtacaactatttctagtttgagtgaaaaaagtaaa
gaagaaactggaataagcttacaggatcttctcttagagatctacagaagcataggagag
ccagacagcctatatggctgtggtggagggaaaatgttacaaccccttactcgaatacgg
acttatgaacatgaagcaatgtgggggaaagccttagtaacatacgacctggagaccaca
atatcttcctcaacccgccagtcaggaataattcaggccttacagaatttggggctctcc
catattctttccatctatttaaaaggattagatcatgaaaatagagagtggtgtgctgaa
ctgcaggaactttattatcaagcagcatggaggaatatgcagtgggacctctgcagttct
gccaaccaagaactagaaggagccagttaccatgagtcattgtataatgctctgcagtct
ctaagaaacaatgaattctccacgttttatgagagtctcagatatgccagagtgaaagaa
gttgaagagttgtgtaagggcagccttgaatctgtatactctctgtatcccatacttagt
agattacaggcccttggagaactggaaaacatgggggagcttttctcaaggtcagtcaca
gatagagattgctctgaagtgtacttgaagtggcagaaacactcccagcttctgaaggac
agtgactttagttttcaggagccactcatggctctacgcacagtaattctggagatcctg
gtacaaaaggaaatggagaactcccaaggaggatgctctaaggacatgctcaccaaacac
cttgtagaattctctgttctagcccgaaccttcaagaacacccagctccctgaaagagca
atatttaaaattaagcaatataattcagctatttgtggagtctctgagtggcatttggaa
gaagcacaagtgttctgggcaaaaaaggagcagagtcttgccttaaatattctcaaacaa
atgatcaagaaattggactccagctttaaagagaatgatgcaggtctaaaggtcatatac
gcagagtgtctgagggtgtgtggcaactggctggcggaaacttgcttagaaaatcctgcg
gtcatcatgcagacctacctagaaaaggcagtgaaagttgctggaagttatgatggcaaa
agcagtgaactcagaaatggacagatgaaggcatttctctcattagcacggttctccgat
actcagtaccagagaattgaaaactacatgaaatcatcagaatttgaaaataagcaagct
ctcttaaaaagagccaaagaagaagtgggccttctaagggaacataaaattcaaactaac
agatacacagtaaaggttcagagagaactggagctagatgaatgtgctctccgtgcactg
aaagaggatcgtaaacgcttcctgtgtaaagcagttgagaactacatcagctgcttgcta
agtggagaagaacaagatatgtgggtattccggctttgctccctctggcttgaaaattct
ggagttcctgaagtcaatggaatgatgaagagagatggaatgaagatttcatcatataaa
tttttgcctctcatgtatcaattggctgctagaatgggaaccaaaatgatgggaggccta
ggatttcatgaagtcctcaataatctgatctctaggatttcaatggatcacccccatcat
actctgttcattatattggccttagcaaatgcaaacaaagatgaacttttgagcaaacca
gaggcagcaaggaggagtagaataaccaaaaatgcacccaaagaaagctcccagcttgat
gaggatcgaacagaagctgcaaccaaaataatccataccatcagaagggagagatgtaag
atggtgaaggacatggaggctctctgtgatgcctacattatattggcaaacttggatgcc
tcccagtggaggagtcagagaaaaggtatcaatatcccaacaaatcagccaatcactaaa
ctgaagaatttagaagatgtagttgttcccactatggaaattaaggttgatcccacagga
gaatatgaaaatctggtgactataaaatcatttaaaacagaatttcgcttggcaggaggt
ttaaatttaccaaaaataatagattgtgtgggttctgatggcaaggaaaggagacagctt
gtcaagggccgtgatgacctgaggcaagatgctgtcatgcaacaggttttccagatgtgc
aatacactactgcagagaaacactgagactagaaagaggaaactcactatctgcacatac
aaggtggttcccctctctcagagaagcggtgttcttgaatggtgcacaggaaccatccct
attggtgaatatcttgtcaacaatgaagaaggtgctcataaaagatacaggccaaatgat
ttcagtgcctttcagtgccaaaagaaaatgatggaagtgcaaaagaagtcttttgaagag
aaatatgacaccttcatgactatttgccaaaactttgaaccagttttccgttacttctgc
atggaaaaattcttggacccagctgtttggtttgagaaacgattggcatatacacgtagt
gtagccacgtcttctattgttggttacatccttggacttggtgataggcatgtacagaat
atcttgataaatgagcagtcagcagaactggtacacatagatttgggagtggcttttgag
cagggtaaaatccttcccactccagaaacagttccatttagactcagcagagatattgtg
gatggcatgggcatcactggtgtggaaggtgtcttcagaagatgctgtgagaaaaccatg
gaagttatgcgcagttctcaggaaactctgctaaccattgtagaggtccttttgtatgat
ccactctttgactggactatgaatcctttaaaagctttgtatttgcagcagaggccagaa
gatgagacagatctccattctacccccaatgcggaagatcaggaatgcaaacgaagtctt
agtgatattgatcagagtttcaacaaagtagctgaacgtgtcttgatgcggttgcaagag
aaattgaaaggcgtggaagaaggcactgtgctcagtgtgggtggacaggtgaacttgctt
atccagcaggccatggatcccaaaaatctcagccgacttttcccaggatggaaagcttgg
gtgtga

DBGET integrated database retrieval system