KEGG   Cricetulus griseus (Chinese hamster): 100754522
Entry
100754522         CDS       T02813                                 

Gene name
E2f2
Definition
(RefSeq) transcription factor E2F2 isoform X2
  KO
K09389  transcription factor E2F2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04110  Cell cycle
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100754522 (E2f2)
   04218 Cellular senescence
    100754522 (E2f2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754522 (E2f2)
   05206 MicroRNAs in cancer
    100754522 (E2f2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100754522 (E2f2)
   05225 Hepatocellular carcinoma
    100754522 (E2f2)
   05226 Gastric cancer
    100754522 (E2f2)
   05214 Glioma
    100754522 (E2f2)
   05220 Chronic myeloid leukemia
    100754522 (E2f2)
   05218 Melanoma
    100754522 (E2f2)
   05219 Bladder cancer
    100754522 (E2f2)
   05215 Prostate cancer
    100754522 (E2f2)
   05224 Breast cancer
    100754522 (E2f2)
   05222 Small cell lung cancer
    100754522 (E2f2)
   05223 Non-small cell lung cancer
    100754522 (E2f2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100754522 (E2f2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754522 (E2f2)
   05161 Hepatitis B
    100754522 (E2f2)
   05160 Hepatitis C
    100754522 (E2f2)
   05163 Human cytomegalovirus infection
    100754522 (E2f2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100754522 (E2f2)
   05169 Epstein-Barr virus infection
    100754522 (E2f2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100754522 (E2f2)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100754522 (E2f2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP PriC FerA CRISPR_Cas2 N1221
Other DBs
NCBI-GeneID: 100754522
NCBI-ProteinID: XP_027255529
LinkDB
Position
2
AA seq 438 aa
MLRAPRTLAPATAQPTKSLPALNPTELWPPGLSSPQLCPATTTTTTYYTSLYTQTVPSAA
ALGTCLDATPHGPEGQIVRCVPAGRLPAKRKLDLEGIGRPSVPEFRTPKGTCIRVDGLPS
PKTPKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLE
GIQLIRKKSKNNIQWVGRGIFEDPTRPAKQQQLGQELKELMNAEQALDQLIQSCSQSFKH
LTEDNANKKLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRAEENLQIYLKSTQGP
IEVYLCPEEVQEPDSPSKEALPSASTLSPVPDLPEPSCSTDPGITETTASSVLMPQPVPP
APAPSLVPLETTDNMLELSHPLLQQTEDQFLSPVLAASSPLISFSPPLDQDEYLWGMDEG
EGISDLFDSYDLGDLLIN
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgctgcgcgcgccgcggaccctggctccggccacggcgcaacccacaaagagcttgccc
gcgttgaaccccaccgagctgtggcctccgggtctcagcagcccccagctgtgtccggcc
accaccaccaccaccacgtactacacttcgctttatacgcagacggtgccttccgctgcg
gcgctgggcacctgcctcgacgccactccccacggacccgagggccagattgtgcgatgt
gtgcccgcaggccggctgccggccaagaggaagctagacctggagggcattgggaggcct
tcggtccctgaattccggactcccaaggggacgtgtatccgagtggatggtttgccaagc
cccaaaacccccaagtctcctggggagaagacacgctatgacacgtcgctggggctgctc
accaagaaattcatttacctcctgagtgagtcggaggatggggtcctggacctgaactgg
gcagccgaagtgctggatgtgcagaagcggcgcatctatgacatcaccaacgtgctggag
ggcatccagctcatccgcaagaagtccaaaaacaacatccagtgggtaggcaggggaata
tttgaagaccccacccgacctgcgaagcagcagcagctggggcaggagctgaaggagctg
atgaatgcagagcaggccttggaccagctcattcagagttgctcgcagagcttcaagcac
ctgaccgaggataatgccaacaagaagttggcctacgtgacctaccaggacatccgtgct
gtgggcaacttcaaggagcagacggtgatcgcagtcaaggcccctccacagacaagattg
gaagtgccagacagggcggaggagaacctgcagatttatctaaagagtacccaagggcct
attgaagtctacctgtgcccagaggaggtacaggaaccagacagtccttccaaggaggcc
ctcccctctgcctctaccctcagccctgtccctgacctccccgagcccagctgcagcacc
gatcctgggatcacagagaccacagcatcttcagtgctgatgccccagccggtcccgcca
gcaccagcaccatcccttgtccccttggaaaccactgacaacatgctggagctgtcacac
ccacttctgcaacagactgaggaccagttcctgtccccagtcctggccgccagctcccct
ctgatcagcttctccccgcccctggaccaggacgaatacctgtggggcatggatgagggt
gagggcatcagtgacctcttcgactcctatgaccttggggacctgttgattaattga

KEGG   Cricetulus griseus (Chinese hamster): 100754647
Entry
100754647         CDS       T02813                                 

Gene name
E2f3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04110  Cell cycle
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100754647 (E2f3)
   04218 Cellular senescence
    100754647 (E2f3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754647 (E2f3)
   05206 MicroRNAs in cancer
    100754647 (E2f3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100754647 (E2f3)
   05225 Hepatocellular carcinoma
    100754647 (E2f3)
   05226 Gastric cancer
    100754647 (E2f3)
   05214 Glioma
    100754647 (E2f3)
   05220 Chronic myeloid leukemia
    100754647 (E2f3)
   05218 Melanoma
    100754647 (E2f3)
   05219 Bladder cancer
    100754647 (E2f3)
   05215 Prostate cancer
    100754647 (E2f3)
   05224 Breast cancer
    100754647 (E2f3)
   05222 Small cell lung cancer
    100754647 (E2f3)
   05223 Non-small cell lung cancer
    100754647 (E2f3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100754647 (E2f3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754647 (E2f3)
   05161 Hepatitis B
    100754647 (E2f3)
   05160 Hepatitis C
    100754647 (E2f3)
   05163 Human cytomegalovirus infection
    100754647 (E2f3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100754647 (E2f3)
   05169 Epstein-Barr virus infection
    100754647 (E2f3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100754647 (E2f3)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100754647 (E2f3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100754647
NCBI-ProteinID: XP_027265112
UniProt: G3GWW4
LinkDB
Position
3
AA seq 458 aa
MRKGIQPALEQYLVTAGGGEGAAVVAAAAAASMDKRALLASPGFAAAAAPGTYIQILTTN
PSTTSCATSLQSSTLAAGPLLPSVPGAEPTAGSLLYSTPQGPSSRAGLLQQPPAPGRGGG
GGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGLLT
KKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLS
EDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKI
SGLKDQTVIVVKAPPETRLEVPDSIESLQIHLASTQGPIEVYLCPEETETHRPMKTNNQD
HNGNIPKPTSKDLASNNSGHSDCSVSTANLSPLASPANLLQQTEDQIPSNLEGPFVNLLP
PLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggctgctgtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttcgccgccgccgccgccccgggcacgtacatccagatcctcactacgaac
ccttccaccacgtcctgtgccacctccctccaaagcagcaccctggccgccggccccctt
ctccccagtgtccccggcgcggagccgaccgccggcagcctcctctacagcacgccacaa
ggaccctccagcagagccgggctgctgcagcagccaccagcaccaggacgcggcggcggc
ggcggccctccggcaaagcgaaggctggagctgggtgagagtggccatcagtacctctca
gatggtctaaaaacccccaagggcaaaggaagagctgcactgcggagtcctgatagtcca
aaaactccaaaatctccctcagaaaaaacgcggtatgatacgtcactcggtctgctcacc
aagaagttcattcagctcctgagccagtcgcctgatggggtcctggatctgaacaaggca
gcagaggtgctcaaagtgcagaagaggaggatttatgacatcaccaacgtgctggaaggc
atccacctcattaagaagaagtctaagaacaacgtccagtggatgggctgcagtctgtct
gaggatgggggcatgctggcccagtgtcaaggcctgtccaaagaagtgaccgagctcagt
caggaagagaagaaattagatgagctgatccaaagctgtaccctggacctcaaactgtta
accgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcgaaaaatt
agtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaagacttgaa
gtgcctgattcaatagagagcctacaaatacatttggcaagtacccaagggcccattgag
gtttacttgtgtccagaagagacagaaacacacagacccatgaaaacaaacaaccaagac
cacaatgggaatatccctaagcccacttccaaagacttggcctctaacaactcaggacat
agcgactgctccgtttccacagcaaacctctctcctctggcctccccagccaacctttta
cagcagactgaggaccaaattccttccaaccttgaaggaccctttgtgaacttactgcct
cccctgctccaagaggactatctactgagcctaggggaggaagagggcatcagcgacctc
tttgatgcatatgatttggaaaagctgcccctcgtggaggacttcatgtgtagttga

KEGG   Cricetulus griseus (Chinese hamster): 100758556
Entry
100758556         CDS       T02813                                 

Gene name
E2f1
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor E2F1 isoform X2
  KO
K17454  transcription factor E2F1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04110  Cell cycle
cge04137  Mitophagy - animal
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100758556 (E2f1)
  09143 Cell growth and death
   04110 Cell cycle
    100758556 (E2f1)
   04218 Cellular senescence
    100758556 (E2f1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100758556 (E2f1)
   05206 MicroRNAs in cancer
    100758556 (E2f1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100758556 (E2f1)
   05225 Hepatocellular carcinoma
    100758556 (E2f1)
   05226 Gastric cancer
    100758556 (E2f1)
   05214 Glioma
    100758556 (E2f1)
   05220 Chronic myeloid leukemia
    100758556 (E2f1)
   05218 Melanoma
    100758556 (E2f1)
   05219 Bladder cancer
    100758556 (E2f1)
   05215 Prostate cancer
    100758556 (E2f1)
   05224 Breast cancer
    100758556 (E2f1)
   05222 Small cell lung cancer
    100758556 (E2f1)
   05223 Non-small cell lung cancer
    100758556 (E2f1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100758556 (E2f1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100758556 (E2f1)
   05161 Hepatitis B
    100758556 (E2f1)
   05160 Hepatitis C
    100758556 (E2f1)
   05163 Human cytomegalovirus infection
    100758556 (E2f1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100758556 (E2f1)
   05169 Epstein-Barr virus infection
    100758556 (E2f1)
   05165 Human papillomavirus infection
    100758556 (E2f1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100758556 (E2f1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100758556 (E2f1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 100758556
NCBI-ProteinID: XP_027277230
LinkDB
Position
6
AA seq 430 aa
MAVAPAGGQRAPAXGALLGAGALRLLDSSQIVIISAAPDVGAPQVPXPPAAARRPATTPA
LATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFRGRGRHPGKGVKSPGEK
SRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSK
NHIQWLGSRTMVGISKRLEGLTRDLQQLQESEQHLDRLMHICTTQLQLLSEDSDSQRLAY
VTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSAETFQISLKSKQGPIDVFLCPEESAGG
ISPGRTPSQETSSGEDRTTDPGTAGPPPPPPSTSPTLDPSQSLLGLEQEPVLSRMGHLRA
PMEEDHLSPLVAADSLLEHVREDFSGLLPGEFISLSPPQEALDYHFGLEEGEGIRDLFDC
DFGDLTPLDF
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccgtggcccccgcgggcggccagcgcgcgccggcgnntggagccctgctcggggcg
ggcgcgctgcggctgctcgactcctcgcagatcgtcatcatctctgccgcgcccgatgtc
ggcgccccgcaggtccccnngccccccgccgccgcccgccggcccgcgacgacgcctgct
ctcgccacgccgcaggcgccccggcccgcgcctagtgcaccgcgtcccgctctcggccgc
ccgccggtgaaacggaggctggatctggaaactgaccatcagtatctggctgggagcagt
gggccgttccggggcagaggccgccacccaggcaaaggtgtgaaatctccaggggagaag
tcacgatatgagacatcgttaaatctgaccaccaaacgcttcttggagctgctgagccgc
tcagctgatggtgttgttgacctgaactgggcggctgaggtgctcaaagtgcagaaacgg
cgcatctatgacatcaccaatgtccttgagggcatccagctcattgccaagaagtccaag
aatcatatccagtggttaggcagccgcaccatggtggggatcagtaagcggcttgaaggc
ttgacccgggacctacagcaactgcaggagagcgagcagcacctggaccgcctgatgcac
atctgtaccacacagctgcagctgctttctgaggactcagacagccagcgcctggcctat
gtgacctgccaggaccttcgtagcatagcggaccctgcagaacagatggtcatagtgatc
aaggcccctcctgagacccaactacaagctgtggactctgcggagacatttcagatctct
cttaagagcaaacaaggccccatcgatgttttcctgtgtcctgaggagagtgcagggggg
atcagccctgggaggaccccatcccaggagacatcctctggggaagacaggaccactgac
cctggcactgcagggcctccaccaccacctccctccacatccccaaccttggatcccagc
cagtccctgctaggcctggagcaagaaccggtattgtcacggatgggccacctgagggcc
cccatggaagaagaccatctgtcaccgctggtggctgccgactcactcctggagcatgtt
cgagaagacttctcggggctcctccctggggagttcatcagcctttccccgccccaagag
gcccttgactaccactttggccttgaggagggtgaaggcatcagagatctctttgactgt
gactttggggacctgacccctctggatttctga

DBGET integrated database retrieval system