KEGG   Cricetulus griseus (Chinese hamster): 100754640Help
Entry
100754640         CDS       T02813                                 

Gene name
Lig4
Definition
(RefSeq) DNA ligase 4
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    100754640 (Lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cge03400]
    100754640 (Lig4)
Enzymes [BR:cge01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100754640 (Lig4)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100754640 (Lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_IV BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme RTT107_BRCT_5 LIG3_BRCT APG17
Motif
Other DBs
NCBI-GeneID: 100754640
NCBI-ProteinID: XP_003495812
UniProt: G3GTP0
LinkDB All DBs
Position
Un
AA seq 912 aa AA seqDB search
MATSQTSQTVAAHVPFADLCSTLERIQKSKERAEKIRHFKEFLDSWRKFHDALHKNKKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDALKLLNYRTPSGART
DAGDFAVIAYFVLKPRCLQKGSLTIQQVNELLDLVASNNSGKRKDLVKKSLLQLITQSSA
LEQKWLIRMIIKDLKLGVSQQTILNIFHNDAVELHNVTTDLEKVCRQLHDPAVGLSDISI
TLFSAFKPMLAAVADVERVEKDMKQQSFYIETKLDGERMQMHKDGSVYQYFSRNGYNYTD
QFGASPQEGTLTPFIHDAFRTDVQVCILDGEMMAYNPTTQTFMQKGVKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRKRYDILNSTFTPIQGRIEIVQKKLAQTKNEVVDALNE
AIDKREEGIMIKHPLSIYKPDKRGEGWLKIKPEYVSGLMDELDLLIVGGYWGKGSRGGMM
SHFLCAVAEKPPHGEKPSVFHTLCRVGSGYTMKELYDLGLKLAKYWKPFHKKSPPSSILC
GTEKPEVYIEPCNSVIVQIKAAEIVPSDMYKTGTTLRFPRIEKIRDDKEWHECMTLGDLE
ELRGKASGKLATKHLHVGDDDEPREKRRKPVSKMKKTIGIIEHLKAPNLSNISKVSNVFE
DVEFCVMSGLDGYPKSDLENRIAEFGGYIVQNPGPDTYCVIAGCENIRVKNIISSDQHDV
VKPEWLLECFKTKTCVPWQPRFMIHMCPSTKQHFAREYDCYGDSYFVDTDLDQLKEVFLG
IKKAGEHQTPEEMAPVIADLEYRYSWDHSPLCMFRHCTVYLDLYAVINDSSSKIKATRLD
VTALELRFHGAKVVSHLSEGVSHVIIGENQSRVSDFKVFRRTLKKKFKILQERWVTDSVD
KGELQEENQYLL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggctacctcacaaacttcacaaactgttgcagctcatgtcccctttgcggatttatgt
tccacattagaacgaatacagaaaagtaaagaacgtgcagaaaagatcaggcactttaag
gaatttttagattcttggagaaaatttcatgatgcccttcataagaacaagaaagatgtt
acagactctttttacccagcaatgagacttattcttcctcagttagaaagagagaggatg
gcttatggaatcaaagaaaccatgcttgctaagctttacattgaattgctgaatttacca
agagaaggcaaggatgccctgaagctcctgaattatcgaacacctagtggagctcgcacg
gatgctggggactttgcagtgatcgcatacttcgttttgaagccaaggtgcttacagaaa
ggaagcttaactatacagcaggtaaatgaactcttagacttagtcgccagcaataattct
ggcaaaagaaaagacctagtgaaaaagagcctccttcagttaataacccagagttcagcc
cttgagcaaaaatggctgattcgtatgattattaaggacttgaagcttggtgtcagtcaa
caaactatacttaacatttttcataatgatgcagttgagttgcacaacgtcaccacagac
ctggaaaaggtctgtaggcagctacacgaccccgctgtagggctcagtgatatctctatc
actctgttttctgcctttaagccaatgctcgctgctgtagcagatgtggaacgcgtggag
aaggacatgaagcagcagagtttctacatcgaaaccaagctggacggggaacgcatgcag
atgcacaaagatgggtcggtgtatcagtacttctccagaaatggctataactacactgat
cagtttggtgcatctccacaggaaggcactctcaccccattcattcatgatgcgttccgg
acagacgtgcaagtatgcatcctcgatggtgagatgatggcctacaacccgaccacacag
actttcatgcaaaagggggtcaaatttgatatcaaaaggatggtggaagattccgaccta
cagacatgttactgtgtttttgatgtgttgatggttaataataagaagctagggcgtgag
actctgagaaagaggtatgatatccttaatagtacttttacacccatccaaggtcgaata
gaaatagtacagaaaaagctagctcagacgaagaacgaagtagtagatgcattaaacgaa
gccatagataagagagaagagggcatcatgatcaaacaccctctgtccatctacaagcca
gacaaaagaggtgaagggtggctaaaaattaaaccagagtatgtcagtggattaatggat
gaattagacctcctaattgtggggggctactgggggaaaggttcacgaggtggcatgatg
tctcactttttgtgtgcagtggcagagaagccccctcatggtgagaagccatctgtattc
catactctgtgtcgtgttgggtcgggatacaccatgaaagaactctatgatcttggcttg
aaattggccaaatactggaagccctttcataagaaatccccaccgagtagtattttatgt
ggaacagagaagccggaagtctacattgagccctgtaactctgttattgttcagattaag
gcagcagagattgtccccagtgacatgtacaagaccggcaccaccttgcgcttcccacgt
atcgagaagatcagagatgacaaagagtggcatgaatgcatgactctgggtgacttagaa
gagctgagggggaaagcatctgggaaacttgccacaaaacaccttcacgtaggtgacgat
gatgaacctagagaaaagaggcggaaacctgtctccaaaatgaagaaaaccattggaatt
attgaacacttgaaagcgcctaacctttctaacataagcaaagtttccaatgtatttgaa
gatgttgagttttgtgttatgagtgggttggatggttatcccaagtctgacctggagaac
agaattgcagaatttggtggttatatagtgcagaatccaggcccagacacatactgtgtg
attgcaggctgtgagaacataagagtgaaaaacattatctcttcagatcaacatgatgtt
gtcaagcctgagtggcttttagagtgttttaaaacaaaaacgtgtgtgccatggcaaccc
cgctttatgattcacatgtgcccatcaacaaagcagcattttgcccgtgaatatgattgc
tatggcgatagctattttgttgatacagatttggatcaactgaaagaagtgtttttagga
attaagaaagcaggtgagcatcagactccggaagagatggcccctgtgattgctgaccta
gaatatcgttattcttgggaccactctcctctctgtatgtttcgacactgcactgtttat
ctggacctgtatgctgttattaatgactcgagttccaaaatcaaagcaacgaggttagat
gtgacagcacttgagctgcggtttcatggagccaaggtagtgtcccacttatctgagggg
gtatctcatgtaatcatcggggaaaatcagagccgagtttcggacttcaaagttttcaga
agaactcttaagaagaagtttaagatccttcaagaacgttgggtgactgattcagtagac
aagggtgaactacaggaggaaaaccagtatttgctttag

DBGET integrated database retrieval system