KEGG   Cricetulus griseus (Chinese hamster): 100754730
Entry
100754730         CDS       T02813                                 

Gene name
Tgfa
Definition
(RefSeq) LOW QUALITY PROTEIN: protransforming growth factor alpha isoform X2
  KO
K08774  transforming growth factor, alpha
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04915  Estrogen signaling pathway
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05223  Non-small cell lung cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100754730 (Tgfa)
   04012 ErbB signaling pathway
    100754730 (Tgfa)
   04014 Ras signaling pathway
    100754730 (Tgfa)
   04151 PI3K-Akt signaling pathway
    100754730 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100754730 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754730 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100754730 (Tgfa)
   05212 Pancreatic cancer
    100754730 (Tgfa)
   05225 Hepatocellular carcinoma
    100754730 (Tgfa)
   05214 Glioma
    100754730 (Tgfa)
   05211 Renal cell carcinoma
    100754730 (Tgfa)
   05215 Prostate cancer
    100754730 (Tgfa)
   05223 Non-small cell lung cancer
    100754730 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100754730 (Tgfa)
SSDB
Motif
Pfam: EGF
Other DBs
NCBI-GeneID: 100754730
NCBI-ProteinID: XP_027284429
LinkDB
Position
8
AA seq 329 aa
MGAQVSRLLLRSVLEQPLAQVTRSLATPLRRLQPGRGYCAGDSGGYCAGDSGGDPGQEHC
GEVSEAWRFLPGPWPGVVTGCRDRGAGPRPRLPVPTPAPSGGRRGGGNLLPVSAAGSVPA
SATGRRGRPSARAPGAGPAACAFFPALTAAARGHXPTAGSAVAAAPCARKMVPAAGQLVL
LALGIVLAVCQALENSTSPLSDSPVAAAVVSHFNECPDSHTQFCFHGTCRFLVQEEKPAC
VCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCHVRKHCE
WCRALVCRHEKPSALLKGRTACCHSETVV
NT seq 990 nt   +upstreamnt  +downstreamnt
atgggggcacaggtctccaggctcctgctccggagtgtcttggagcagcccctggcgcag
gtgactagatccttggcgactccgctccgccgcctacagcctggacgcggctactgcgca
ggggactcgggcggctactgcgcaggggactcgggcggcgaccctgggcaagagcactgc
ggggaggtgtctgaagcctggcgcttcctgcctggcccttggcccggggtggtgactggc
tgtcgcgatcggggtgcgggtccccgcccccggctcccagtccccacccctgcgccctcg
ggggggcggagaggtggcgggaacctccttcccgtttccgccgcgggcagcgtgccggcc
agtgccaccgggaggcgcggtcgtccctccgcccgcgcgccgggggccggccctgccgcc
tgcgcctttttccccgcgctcaccgcggcggcgcgcggccactagccaaccgcagggagc
gcggtggctgcagcgccctgcgctcggaagatggtccccgcggccggacagctcgttctg
ctagcgctgggtatcgtgttagctgtgtgccaggctctggagaacagcacatcccccctg
agtgactcacccgtggcagctgcagtggtgtctcatttcaacgagtgtccagattcccac
actcagttctgcttccatggaacctgcaggtttttggttcaggaggagaagccagcatgt
gtctgccactctggatatgtgggtgctcgctgtgagcatgcagacctcctggctgttgtg
gctgccagccagaagaagcaggccatcactgccttggtggtggtctccattgtggccctg
gctgtcctgattatcacctgtgtgctgatccactgctgccacgtccgcaaacactgtgag
tggtgccgtgccctcgtctgcagacacgagaagcccagcgccctcctgaagggaaggacc
gcttgctgccactctgagacagtggtctga

DBGET integrated database retrieval system