KEGG   Cricetulus griseus (Chinese hamster): 100754737
Entry
100754737         CDS       T02813                                 

Gene name
Cbl
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL isoform X2
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04012  ErbB signaling pathway
cge04120  Ubiquitin mediated proteolysis
cge04144  Endocytosis
cge04910  Insulin signaling pathway
cge05100  Bacterial invasion of epithelial cells
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100754737 (Cbl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100754737 (Cbl)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100754737 (Cbl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100754737 (Cbl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754737 (Cbl)
   05205 Proteoglycans in cancer
    100754737 (Cbl)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100754737 (Cbl)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100754737 (Cbl)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100754737 (Cbl)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100754737 (Cbl)
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100754737 (Cbl)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 100754737
NCBI-ProteinID: XP_027267713
LinkDB
Position
4
AA seq 913 aa
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPGTVDKKMVEKCWKL
MDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENL
MKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRIT
KADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFD
IFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQ
WAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIK
VTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCE
IKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAKVERPS
SPFSMAPQASLPPVPPRLDLLQQRPSVPASSSVLGTTSKAASGSLHKDKPLPIPPTLRDL
PPPPPPDRPYSVGTETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLPRPIPKVPIAT
PSPNDPWNGRELTNRHSLPFSLPSQMEPRVDVPRLGSTFSLDTSMNMNSSPIAGPENEHP
KIKPSSSANAIYSLAARPLPVPKLPPGEQGESEEDAEYMTPTSRPVGAQKPEPKRPLEAT
QSSRACDCDQQIDSCTYEAMYNIQSQALSVTENSTFGEGNLATAPTSTGPEESENEDDGY
DVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTTNFNEGSQVPERPPKPFPRRINSE
RKASSCQQGGATANPSATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
NT seq 2742 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaaaaagagctcgggagctggcggcggcggctcggggggctcgggc
gcgggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccaccac
ctcagcccgcaccctcccggcacggtggacaagaagatggtggagaagtgctggaagctc
atggacaaggtggtgcggttgtgtcaaaacccgaagctggcgctcaagaacagcccacct
tatatcttagacctgctacctgacacctaccagcatctccgcactgtcttgtcaagatat
gaggggaagatggagacacttggagaaaatgaatattttagagtgttcatggagaatttg
atgaagaaaactaagcagactataagcctcttcaaggagggaaaagaaagaatgtatgag
gagaattctcagcctaggcgaaacctaaccaaactatccctgatcttcagccacatgctg
gcagaattgaaaggtatctttccaagtggactcttccaaggagacacttttcggattact
aaagcagatgctgcagaattttggagaaaagcttttggggaaaagacaatagttccttgg
aagagctttcgacaggcccttcatgaagtgcaccccatcagttctgggctggaggccatg
gctctgaagtccactattgatctgacttgcaatgattatatatctgtttttgaatttgat
atctttacacgactgtttcagccatggtcctctttgcttagaaattggaacagccttgct
gtaactcaccctggttacatggctttcttgacatatgatgaagtgaaagcacggctccag
aagttcattcacaagcctggcagttacatctttcggctgagctgtactcgtctgggtcag
tgggctatcgggtatgttactgctgatgggaacattctgcagacaatcccacacaataaa
ccgctctttcaagcactgattgatggcttcagggaaggcttctatttatttcctgatgga
cgaaatcagaatcccgacctgacaggtttatgtgaaccaactccacaagatcatatcaaa
gtaacccaggaacaatatgaattatactgtgagatgggctctacatttcaactatgtaaa
atatgtgctgaaaatgataaggatgtaaagattgaaccctgtggccacctcatgtgcaca
tcctgccttacatcatggcaggaatcagaaggtcaaggctgtcctttttgccgatgtgaa
atcaaaggtacagagcccatcgtggtggatccattcgaccccagaggcagtggcagtctc
ttaagacaaggagcagaaggagctccttccccaaattatgatgatgatgatgatgaacga
gctgatgactctcttttcatgatgaaggagttggcaggtgccaaggtggaaaggccttcc
tctccattctccatggctccacaagcttcccttcctccagtgccaccaagacttgatctt
ctacaacagcgaccatctgttcctgctagctcttcagttctggggactacttccaaggct
gcttctggctctcttcataaagacaaaccattgccaatacctcccacacttcgagatctt
ccaccaccacctcctccagaccggccttactctgttgggacagaaacacggcctcagaga
cgtcccctgccttgtacaccaggcgattgtccatctagagacaaactgccccctgtcccc
tctagccgcccaggggactcatggttgcctcggccaatccctaaagtaccaatagctacc
ccaagccctaatgatccttggaatggaagagaactgactaatcggcactcacttccattt
tcattgccctcacaaatggaacccagagtagatgttcctaggcttggaagcacatttagt
ctggatacttccatgaatatgaatagcagtccaatagcaggtccagagaatgagcaccca
aaaatcaagccttcctcatctgccaatgctatttactctctggctgccaggcctcttcct
gtgccaaaactgccacctggggaacagggggaaagtgaagaggacgcagagtacatgact
cccacatctaggcctgtaggggctcagaagccagagcccaagcgacctttagaggcaacc
cagagttcacgagcatgtgactgtgaccagcagattgacagctgcacatatgaagcaatg
tataacattcagtcccaagcactatctgtaacggaaaacagtacctttggggaagggaat
ttggctacagcccccaccagtactggccctgaggagtcagaaaatgaggatgatggctac
gatgtgcctaagccgcctgtgccggctgtactggctcgccggactctgtctgacatctct
aatgccagctcctcctttggctggttatctctggatggtgatcctacaacaaacttcaat
gagggttcccaagttcctgagcggccccctaaaccattccctcggagaatcaactctgaa
cgaaaagcaagcagctgtcagcaaggtggtgccactgctaatccttctgccactgccccc
tcaccacagctctcgagtgagattgagcgtctcatgagtcagggctactcgtaccaggac
attcagaaagctttggtcattgcccacaacaacattgagatggccaaaaacatcctccgg
gaatttgtttctatttcttctcctgcccacgtagctacctag

DBGET integrated database retrieval system