KEGG   Cricetulus griseus (Chinese hamster): 100754788
Entry
100754788         CDS       T02813                                 

Gene name
Cacna1c
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X30
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04260  Cardiac muscle contraction
cge04261  Adrenergic signaling in cardiomyocytes
cge04270  Vascular smooth muscle contraction
cge04713  Circadian entrainment
cge04720  Long-term potentiation
cge04723  Retrograde endocannabinoid signaling
cge04724  Glutamatergic synapse
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04727  GABAergic synapse
cge04728  Dopaminergic synapse
cge04742  Taste transduction
cge04911  Insulin secretion
cge04912  GnRH signaling pathway
cge04921  Oxytocin signaling pathway
cge04924  Renin secretion
cge04925  Aldosterone synthesis and secretion
cge04927  Cortisol synthesis and secretion
cge04929  GnRH secretion
cge04930  Type II diabetes mellitus
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05410  Hypertrophic cardiomyopathy
cge05412  Arrhythmogenic right ventricular cardiomyopathy
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100754788 (Cacna1c)
   04020 Calcium signaling pathway
    100754788 (Cacna1c)
   04024 cAMP signaling pathway
    100754788 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    100754788 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100754788 (Cacna1c)
   04929 GnRH secretion
    100754788 (Cacna1c)
   04912 GnRH signaling pathway
    100754788 (Cacna1c)
   04921 Oxytocin signaling pathway
    100754788 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    100754788 (Cacna1c)
   04924 Renin secretion
    100754788 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    100754788 (Cacna1c)
   04927 Cortisol synthesis and secretion
    100754788 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    100754788 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    100754788 (Cacna1c)
   04270 Vascular smooth muscle contraction
    100754788 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    100754788 (Cacna1c)
   04727 GABAergic synapse
    100754788 (Cacna1c)
   04725 Cholinergic synapse
    100754788 (Cacna1c)
   04728 Dopaminergic synapse
    100754788 (Cacna1c)
   04726 Serotonergic synapse
    100754788 (Cacna1c)
   04720 Long-term potentiation
    100754788 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    100754788 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    100754788 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100754788 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100754788 (Cacna1c)
   05020 Prion disease
    100754788 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    100754788 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    100754788 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100754788 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100754788 (Cacna1c)
   05414 Dilated cardiomyopathy
    100754788 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100754788 (Cacna1c)
   04934 Cushing syndrome
    100754788 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cge04040]
    100754788 (Cacna1c)
Ion channels [BR:cge04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100754788 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 100754788
NCBI-ProteinID: XP_035304783
LinkDB
Position
8
AA seq 2214 aa
MVNENTRMYVPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGGTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGVIDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNRGAAAGLLDQKKGKFAW
FSHSTETHVSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRR
KCRAAVKSNIFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKM
YSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWN
SLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQS
LLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDN
LADAESLTSAQKEEEEEKERKKLARPARTASPEKKQEVMEKPAVEETKEEKIELKSITAD
GESPPTTKINMDDLQPSENEDKSPHSNPDTAGEEDEEEPEMPVGPRPRPLSELHLKEKAV
PMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHI
LFYFDIVFTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWE
NSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIA
FKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVH
PAEHTQCSPSMSAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVA
LLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLA
CMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
SMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPE
IRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDSRSNFPQTFTT
QRPLHINKTGNNQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPTGY
SSTVSTVEGHGPPLSPAIRVQEAAWKLSSKRCHSRESQGASVSQEMFPEETCSVRMSEDA
EYCSEPSLLSTDILSYQDDENRQLTSPEDRREIQQSPKRSFLRSASLGRRASFHLECLKR
QKDQGGDISQKTALPLHLVHHQALAVAGLSPLLQRSHSPTKIPRACPTPPVTPGSRGRPL
QPIPTLRLEGAESSEKLNSSFPSIPCSSWSDETTACSGGSSMARRARPVSLTVPSQAGAP
GRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGG
AQQSPNGTLLPFVNCRDPGQDRAVVPEDESCAYALGRGRSEEALPDSRAYVSNL
NT seq 6645 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacgttccagaggaaaaccaccaaggttccaactat
gggagcccacgcccagctcacgccaacatgaatgccaatgcagctgcagggctcgcccct
gagcacatccctactccgggggcagcactgtcctggcaggcagccattgatgctgcccgg
caggccaagctaatgggcagtgctggcaacgcaaccatctctaccgtcagttccacacag
cggaagcggcagcagtacgggaaacccaagaagcagggtggtacgactgccacacggcca
ccccgtgctctgctctgcctgactctgaagaaccccatccggagggcatgcataagcatt
gttgaatggaaaccatttgaaataattattttactgactatttttgccaattgtgtggcc
ttagcgatctatatcccctttccagaagatgactccaacgccaccaactccaacctggaa
cgagtggaatatctctttctcatcatttttaccgtggaagcatttttaaaagtaattgcc
tatggacttctctttcaccccaatgcttacctccgaaatggttggaatttactagatttt
ataattgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagctgatggg
gccaatgctctaggagggaaaggagctggattcgatgtgaaggcgctgagggctttccgt
gtgcttcgtcccctgcggctggtgtctggagtcccaagtctccaggtggtcctgaactcc
atcatcaaggccatggtgcccctactgcacattgccctacttgtgctgttcgtcatcatc
atttatgccattatcggcctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggagtaatagatgttccagcagaagaggacccttccccttgtgctttggagaca
ggccatgggcggcagtgtcagaacggcaccgtgtgcaagcccgggtgggatgggcccaaa
catggcatcaccaacttcgacaacttcgccttcgccatgctgacagtgttccagtgtatc
accatggagggctggacggacgtgctgtattgggtcaatgatgccgtaggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgttcttagcggagagttttccaaagaaagggagaaagccaaagctcggggggat
ttccaaaagcttcgagagaagcagcagctagaagaagatctcaaaggctacctggattgg
atcacccaagcggaagacattgaccctgagaatgaagatgagggcatggacgaagacaaa
ccccgaaacagaggcgctgcagcgggcttgcttgatcagaagaaagggaagtttgcttgg
tttagtcactctacagaaacccatgtgagcatgcccacaagtgagactgagtctgtcaac
actgaaaatgtggctggaggtgacatcgagggcgagaactgtggagccaggcttgcccac
cggatctccaaatccaagttcagccgctactggcgcaggtggaatagattctgcagaagg
aagtgccgtgcggcagttaagtccaacatcttctactggcttgtgatcttcctggtgttc
ctcaacacgctcaccattgcctcagagcactacaaccagccccactggctcacagaagtc
caagacacagccaacaaggcactgctggcccttttcactgcagaaatgctcctgaagatg
tacagcctaggtctgcaggcctattttgtatctctcttcaaccgctttgactgtttcatc
gtgtgtgggggcatcctggagaccatcctggtggagacgaagatcatgtcccccctgggc
atctctgtgctgagatgtgtgcggctgctcagaatctttaagatcaccaggtactggaac
tccttgagcaaccttgtggcgtccttgctgaactcagtgcgctccatcgcctccctgctg
ctgcttctcttcctgttcatcatcatcttctccctcctggggatgcagctgtttggcggg
aagttcaactttgatgagatgcagacccgtaggagcacgtttgataacttcccacagtcg
ctcctcactgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatggg
atcatggcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatc
ctcttcatctgtggaaattatatcctactgaatgtgttcttggccattgcggtggacaac
ctagctgatgccgagagcctcacctctgcccaaaaagaagaagaagaagagaaggagaga
aagaagctggccagaccggccaggactgccagcccagaaaagaaacaggaggtgatggag
aagccagcagtggaggagaccaaagaggagaaaattgagctgaagtccattactgcagat
ggagagtccccacccactaccaagatcaacatggatgacctccagcccagtgaaaatgaa
gataagagtccccactccaacccagacactgcaggggaagaggacgaggaggagcctgag
atgcctgtagggccacgcccccggcccctgtctgagctacacctgaaggaaaaggcagtg
cccatgccagaagccagtgcgtttttcatcttcagcccgaacaacaggttccgcctccag
tgccaccgaatcgtcaacgacaccatcttcaccaacctgatcctcttcttcatcctgctc
agcagcatctctctggctgctgaggacccagtccagcacacctccttcaggaaccatatt
ctgttttattttgacattgttttcactaccattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattatccttaagatg
actgcttacggggctttcctgcacaagggctctttctgccgaaattacttcaatatcttg
gacctgctggtggttagcgtgtccctcatctcctttggcatccagtccagtgcaatcaat
gttgtgaagattttacgagtgctgcgggtcctcaggcccctgagggccatcaacagggcc
aaggggctaaagcatgtagttcagtgtgtgtttgtggccatccggaccatagggaacatt
gtgattgtcaccaccctgctgcagttcatgttcgcctgcattggggtccagctcttcaag
ggaaagctctatacctgttcggatagttccaaacagaccgaggcagaatgcaagggtaac
tatatcacatacaaagatggagaggttgaccaccccattatccaacctcgaagctgggag
aacagcaagtttgactttgacaatgttctggcagccatgatggcccttttcaccgtctcc
acctttgaggggtggccagagctgctgtaccgctccatcgactcccacacagaagacaag
ggccccatctacaactaccgcgtggagatctccatcttcttcatcatctacatcatcatc
attgccttcttcatgatgaacatcttcgtgggtttcgtcattgtcaccttccaggagcag
ggggagcaagagtacaagaactgtgagctggacaagaaccagagacaatgtgtagaatat
gccctcaaggcccgacctttacgaaggtacatccccaagaaccagcaccagtataaagtg
tggtacgtggtcaactctacctacttcgagtatctgatgttcgtccttatcctgctcaac
accatctgcctggccatgcagcattatggccagagctgcctcttcaaaattgccatgaat
atactcaacatgcttttcactggcctcttcacggtggagatgatcctgaagctcattgcc
ttcaaacccaagggttactttagtgatccctggaatgtttttgacttcctcatcgtgatt
gggagcataattgatgtcattctcagtgaaactaatcactatttctgtgatgcatggaat
acatttgatgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtacac
ccagctgaacatactcaatgctctccctctatgagcgcagaggagaactcccgcatctcc
atcaccttcttccgcctcttccgggtcatgcgcctggtgaagctgctgagccgtggggaa
ggcatccggaccctgctgtggaccttcatcaagtctttccaggccctgccctatgtggcc
cttctgattgtgatgctgtttttcatctatgcagtgattgggatgcaggtgtttgggaag
atcgccttgaatgacaccacagagatcaatcggaacaacaacttccagacgttcccacag
gctgtactactgctcttcaggtgtgccactggggaagcctggcaggatatcatgctggcc
tgtatgccgggcaagaagtgcgccccagagtctgagcccagcaacagcacggaaggggag
accccctgtggcagcagctttgctgtcttctacttcatcagcttctacatgctctgtgcc
ttcctgatcatcaacctcttcgtagccgttatcatggacaattttgactacctgacaagg
gattggtctatccttggtccccatcatctggatgaattcaaaaggatctgggccgagtat
gaccctgaagccaagggtcggataaaacacttggatgtggtgaccctcctccgtcgaatt
cagccccccttgggttttgggaagttgtgtcctcaccgtgtggcctgcaaacgcctggtg
tctatgaacatgcctctgaacagcgatgggacagtcatgttcaatgctaccctgtttgcc
ctagtcaggacagccctgaggatcaaaacggaagggaacttagaacaagccaatgaggag
ctgcgggccatcatcaagaaaatctggaagaggaccagcatgaagctgttggaccaagtg
gtgccccctgcaggtgatgatgaggtcacagtaggcaagttctacgccaccttcctgatc
caagagtacttccgaaaattcaagaagcgaaaagagcaaggtttggtgggaaagccttca
cagaggaatgcactgtccctgcaggctggattacgcacattgcatgatattgggcctgag
atccgacgggccatctctggggatcttaccgctgaggaggagttggacaaggctatgaag
gaggctgtgtctgctgcctctgaagacgacatcttcaggagagctggaggcctgtttggc
aaccatgtcagctactatcaaagtgacagcaggagcaactttcctcagaccttcactacc
cagcgcccactgcatatcaacaagacgggaaacaaccaaggtgacaccgagtcaccatcc
catgagaagctagtggactccactttcacccccagcagctactcatccacaggttccaat
gccaacatcaacaatgccaacaacactgccctgggccgcttcccccatcccactggctac
tccagcacagtcagcactgtggagggccatgggcctcccttgtcccctgctatccgggta
caggaggcagcatggaagctcagctctaagaggtgccactcccgagagagccagggggcc
tcggtgagtcaagagatgtttccagaagagacctgcagtgtgagaatgagtgaggacgct
gagtactgcagtgagcccagcctgctctccacagatatactctcctaccaggatgatgaa
aacagacaactgacatctccagaggataggagggagatccagcaatctccaaagaggagt
ttcctccgctctgcctctctaggtcgaagggcctccttccacctggaatgtctgaagaga
caaaaggatcaagggggagacatatctcagaaaacagccttgcccttgcatctggttcat
catcaggcattggcagtggcaggtttgagtcccctcctgcagagaagccattctcctacc
aagatccccagggcatgccccacaccccctgtcacccctggcagccggggcaggccccta
cagcccatccccaccctacgactggagggggctgagtccagcgagaaactcaacagcagc
ttcccatccatcccctgcagctcctggtctgacgagaccactgcctgtagtgggggcagc
agcatggctcggagagcccggcctgtctccctcaccgtgcccagccaggctggagctccg
gggagacagttccatggcagtgccagcagcctggtggaagcggtcttgatttcagaagga
ctgggacagtttgctcaagatcccaagttcatcgaggtcaccacccaggagttggccgac
gcctgtgacatgacgatagaggagatggagaatgcggcagacaacatcctcagtgggggc
gcccagcagagccccaacggcaccctcttaccttttgtgaactgcagggacccggggcag
gacagggctgtggtcccagaggacgagagctgcgcatatgccctggggcgaggccggagc
gaggaggcgctcccggacagcagggcctacgtcagcaacctgtag

DBGET integrated database retrieval system