KEGG   Cricetulus griseus (Chinese hamster): 100755105Help
Entry
100755105         CDS       T02813                                 

Gene name
Gaa
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100755105 (Gaa)
   00500 Starch and sucrose metabolism
    100755105 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100755105 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100755105 (Gaa)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100755105 (Gaa)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100755105 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100755105
NCBI-ProteinID: XP_003506744
UniProt: G3HTE5
LinkDB All DBs
Position
Un
AA seq 949 aa AA seqDB search
MRKPPCSNSLIGACTLVSLVSAVILGHLMLRDFLLFPQEPPESSLGLQKTFRPHHRAGYR
PGPQHIREHPEQPTAVPTQCDVPPNNRFDCAPDKGISQEQCEARGCCYVPAGQVLMGQPW
CFFPPTYPSYRLENLSSTEMGYTATLTRTSPTFFPKDVLSLQLDVLMETESRLHFMIKDP
ANKRYEVPMETPRVLSRAPSQLYSVEFSEEPFGVIVRRKLDGRVLLNTTVAPLFFADQFL
QLSTSLPSPHITGLAEHLSPLMLSTEWTRVTLWNRDVPPSPGTNLYGSHPFYLVLEDGGL
AHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLEVVGYPFMPPY
WGLGFHLCRWGYSSTAIVRQVVENMTRAHFPLDVQWNDLDYMDTRKDFTFTQDGFADFPD
MVRELHQGGRRYIMILDPAISSSGPAGSYRPYDEGLRRGVFITNSTGQPLIGKAWPGSST
FPDFTNPETLVWWKDMVSEFHAQVPFDGIWIDMNEPSSFIRGSQWGCPDNELENPPYVPA
VVGGALQAATICASSRQFLSTHYNLHNLYGLTQAIASNRALVKTRGTRPFVISRSTFAGH
GQYAGHWTGDVSSSWEHLSYSVPDILQFNLVGVPLIGADICGFLGDTSEELCVRWTQLGT
FYPFMRNHNDYKSKPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHIRGDTVARP
LFLEFPEDPNTWSVDRQLLWGSALLITPVLEPGKTEVTGYFPEGTWYNLQMVPMEGLGSL
PSPPSSLPSPLRSVVHSKGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQPMAL
AVALTASGEAYGELFWDDGESLDALERGAYTQVTFLAKNDTIVNELVHVAKEGADLQLRK
VTVLGVATAPTQVLSNGVPVSNFTYSPESKILAIPVSLLMGEQFQIDWS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagccgccctgctccaactccctgatcggggcctgcactctcgtctccttggtt
tctgctgtcattctgggtcatctcatgctccgtgacttcctgctgtttccccaagagcct
cctgagtcctctctaggactgcagaagacttttagacctcaccatcgggcaggttaccgg
cctgggccccagcacatccgggagcaccctgagcagcccacagcagtgcccacacagtgt
gatgtgccccccaacaaccgctttgactgtgccccagacaagggcatctcccaggaacag
tgcgaggcccgtggctgctgttatgtcccagcagggcaggtgctgatgggacaaccctgg
tgtttcttccctcccacctacccaagctaccggctagagaacctgagctccacagagatg
gggtacacagccaccctgacccgtaccagcccgaccttcttcccaaaagatgtgctgagc
ttacagctagatgtgctgatggagacggagagccgcctgcactttatgatcaaagatcct
gctaataagcgctacgaagtgcccatggagacccctcgtgtcctgagccgggcaccatcc
caactctatagtgtggaattctcagaggagccctttggagtgattgtccgcaggaagctg
gatggccgggtgctgctgaacactaccgtggctccgctgttctttgctgaccagttcctg
cagctgtccacatcactgccctccccgcacatcactggcctcgctgagcacctgagccca
ctcatgctcagcactgaatggactcgggtcaccctctggaaccgggacgtgccaccctcg
ccaggtaccaacctctatgggtcacaccctttctacctggtgctggaggatggtggcttg
gctcatggtgtcttcctgctgaacagcaatgccatggatgtggtcctgcagcccagccca
gccctaacctggaggtcaacaggtgggatcttggatgtgtacgtgttcctaggcccagag
cccaagagcgttgtgcagcagtaccttgaagttgtgggataccccttcatgccgccatac
tggggcctgggtttccacctctgccgctggggctactcctccactgctattgtccgccag
gtggtggagaacatgaccagggcacacttccccctggatgtgcagtggaacgacctggac
tacatggacacccgcaaggacttcaccttcacccaggacgggtttgcagacttcccagac
atggttcgagagctccaccaaggtggccggcggtacataatgatattggaccctgccatc
agcagttcaggccctgctgggagttacaggccctatgacgaaggtcttcggaggggcgtg
ttcatcaccaactcgactgggcagccgctaattgggaaggcatggcctggatctagcacc
ttccccgatttcaccaaccctgagacccttgtctggtggaaggacatggtgtctgagttc
cacgcccaggtgcccttcgatggaatatggattgacatgaacgagccatccagcttcatt
agaggctcccagtggggctgccctgacaacgaactggagaacccaccctatgtgcccgcg
gtggttggcggggccttgcaggcagccaccatctgtgcctccagccgccagttcctctcc
acacactacaacctccacaacctgtatggcttgacccaagccatcgcctccaacagggcc
ctagtgaagacccggggaacacgaccctttgtgatctcccgttcaaccttcgctggccat
ggccaatatgctggtcactggacaggggatgtgtcgagctcctgggagcatctttcttac
tctgtgccagatatcctgcagtttaacctggtaggcgtgccgctgattggggcagacatc
tgtggcttcctgggagacacatctgaggagttgtgtgtacgctggacccaattggggacc
ttctaccccttcatgcggaatcacaatgactacaaaagcaagcctcaggagccatacagg
ttcagcgagaccgcacagcaggccatgaggaaggccttcactttgcgttatgcccttctg
ccctacctgtacactctcttccatggagcccatatcagaggggacacagtggcccggccc
ctcttcctggagttccctgaggatcccaacacctggtctgtggaccgccagctcttgtgg
ggatcagccctgctcatcacacctgtgcttgagcctgggaaaactgaagtgactggctac
ttccccgagggcacgtggtacaacctgcagatggtgccaatggagggccttggcagcctc
ccatctcctccatcatctctgccatcacccctcaggtctgttgtgcacagcaaggggcag
tggctgacgctcgaagcccctctggataccatcaatgtgcacctgagggcaggatacatc
ataccactgcagggccccagcctcacaaccacagaatcccgaaagcagcccatggccctg
gctgtggcgttaacagcaagcggcgaggcctatggggagctgttctgggatgacggggag
agcctagatgctctggagcgtggggcctacacacaagtcaccttcttggccaagaacgat
accattgtgaatgagttagtacacgtggccaaggagggagctgacctacagctgaggaag
gtgaccgtcttgggagtagccacagcccctacacaagtcctttccaatggtgtccctgtc
tccaatttcacctacagccctgaaagcaagatcctggccatccctgtctcactgctcatg
ggagagcagtttcagattgactggtcctag

DBGET integrated database retrieval system