KEGG   Cricetulus griseus (Chinese hamster): 100755105Help
Entry
100755105         CDS       T02813                                 

Gene name
Gaa
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04142  Lysosome
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100755105 (Gaa)
   00500 Starch and sucrose metabolism
    100755105 (Gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100755105 (Gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100755105 (Gaa)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100755105 (Gaa)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100755105 (Gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100755105
NCBI-ProteinID: XP_027281295
UniProt: G3HTE5
LinkDB All DBs
Position
7
AA seq 949 aa AA seqDB search
MRKPPCSNSLIGACTLVSLVSAVILGHLMLRDFLLFPQEPPESSLGLQKTFRPHHRAGYR
PGPQHIREHPEQPTAVPTQCDVPPNNRFDCAPDKGISQEQCEARGCCYVPAGQVLMGQPW
CFFPPTYPSYRLENLSSTEMGYTATLTRTSPTFFPKDVLSLQLDVLMETESRLHFMIKDP
ANKRYEVPMETPRVLSRAPSQLYSVEFSEEPFGVIVRRKLDGRVLLNTTVAPLFFADQFL
QLSTSLPSPHITGLAEHLSPLMLSTEWTRVTLWNRDVPPSPGTNLYGSHPFYLVLEDGGL
AHGVFLLNSNAMDVVLQPSPALTWRSTGGILDVYVFLGPEPKSVVQQYLEVVGYPFMPPY
WGLGFHLCRWGYSSTAIVRQVVENMTRAHFPLDVQWNDLDYMDTRKDFTFTQDGFADFPD
MVRELHQGGRRYIMILDPAISSSGPAGSYRPYDEGLRRGVFITNSTGQPLIGKAWPGSST
FPDFTNPETLVWWKDMVSEFHAQVPFDGIWIDMNEPSSFIRGSQWGCPDNELENPPYVPA
VVGGALQAATICASSRQFLSTHYNLHNLYGLTQAIASNRALVKTRGTRPFVISRSTFAGH
GQYAGHWTGDVSSSWEHLSYSVPDILQFNLVGVPLIGADICGFLGDTSEELCVRWTQLGT
FYPFMRNHNDYKSKPQEPYRFSETAQQAMRKAFTLRYALLPYLYTLFHGAHIRGDTVARP
LFLEFPEDPNTWSVDRQLLWGSALLITPVLEPGKTEVTGYFPEGTWYNLQMVPMEGLGSL
PSPPSSLPSPLRSVVHSKGQWLTLEAPLDTINVHLRAGYIIPLQGPSLTTTESRKQPMAL
AVALTASGEAYGELFWDDGESLDALERGAYTQVTFLAKNDTIVNELVHVAKEGADLQLRK
VTVLGVATAPTQVLSNGVPVSNFTYSPESKILAIPVSLLMGEQFQIDWS
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagccgccctgctccaactccctgatcggggcctgcactctcgtctccttggtt
tctgctgtcattctgggtcatctcatgctccgtgacttcctgctgtttccccaagagcct
cctgagtcctctctaggactgcagaagacttttagacctcaccatcgggcaggttaccgg
cctgggccccagcacatccgggagcaccctgagcagcccacagcagtgcccacacagtgt
gatgtgccccccaacaaccgctttgactgtgccccagacaagggcatctcccaggaacag
tgcgaggcccgtggctgctgttatgtcccagcagggcaggtgctgatgggacaaccctgg
tgtttcttccctcccacctacccaagctaccggctagagaacctgagctccacagagatg
gggtacacagccaccctgacccgtaccagcccgaccttcttcccaaaagatgtgctgagc
ttacagctagatgtgctgatggagacggagagccgcctgcactttatgatcaaagatcct
gctaataagcgctacgaagtgcccatggagacccctcgtgtcctgagccgggcaccatcc
caactctatagtgtggaattctcagaggagccctttggagtgattgtccgcaggaagctg
gatggccgggtgctgctgaacactaccgtggctccgctgttctttgctgaccagttcctg
cagctgtccacatcactgccctccccgcacatcactggcctcgctgagcacctgagccca
ctcatgctcagcactgaatggactcgggtcaccctctggaaccgggacgtgccaccctcg
ccaggtaccaacctctatgggtcacaccctttctacctggtgctggaggatggtggcttg
gctcatggtgtcttcctgctgaacagcaatgccatggatgtggtcctgcagcccagccca
gccctaacctggaggtcaacaggtgggatcttggatgtgtacgtgttcctaggcccagag
cccaagagcgttgtgcagcagtaccttgaagttgtgggataccccttcatgccgccatac
tggggcctgggtttccacctctgccgctggggctactcctccactgctattgtccgccag
gtggtggagaacatgaccagggcacacttccccctggatgtgcagtggaacgacctggac
tacatggacacccgcaaggacttcaccttcacccaggacgggtttgcagacttcccagac
atggttcgagagctccaccaaggtggccggcggtacataatgatattggaccctgccatc
agcagttcaggccctgctgggagttacaggccctatgacgaaggtcttcggaggggcgtg
ttcatcaccaactcgactgggcagccgctaattgggaaggcatggcctggatctagcacc
ttccccgatttcaccaaccctgagacccttgtctggtggaaggacatggtgtctgagttc
cacgcccaggtgcccttcgatggaatatggattgacatgaacgagccatccagcttcatt
agaggctcccagtggggctgccctgacaacgaactggagaacccaccctatgtgcccgcg
gtggttggcggggccttgcaggcagccaccatctgtgcctccagccgccagttcctctcc
acacactacaacctccacaacctgtatggcttgacccaagccatcgcctccaacagggcc
ctagtgaagacccggggaacacgaccctttgtgatctcccgttcaaccttcgctggccat
ggccaatatgctggtcactggacaggggatgtgtcgagctcctgggagcatctttcttac
tctgtgccagatatcctgcagtttaacctggtaggcgtgccgctgattggggcagacatc
tgtggcttcctgggagacacatctgaggagttgtgtgtacgctggacccaattggggacc
ttctaccccttcatgcggaatcacaatgactacaaaagcaagcctcaggagccatacagg
ttcagcgagaccgcacagcaggccatgaggaaggccttcactttgcgttatgcccttctg
ccctacctgtacactctcttccatggagcccatatcagaggggacacagtggcccggccc
ctcttcctggagttccctgaggatcccaacacctggtctgtggaccgccagctcttgtgg
ggatcagccctgctcatcacacctgtgcttgagcctgggaaaactgaagtgactggctac
ttccccgagggcacgtggtacaacctgcagatggtgccaatggagggccttggcagcctc
ccatctcctccatcatctctgccatcacccctcaggtctgttgtgcacagcaaggggcag
tggctgacgctcgaagcccctctggataccatcaatgtgcacctgagggcaggatacatc
ataccactgcagggccccagcctcacaaccacagaatcccgaaagcagcccatggccctg
gctgtggcgttaacagcaagcggcgaggcctatggggagctgttctgggatgacggggag
agcctagatgctctggagcgtggggcctacacacaagtcaccttcttggccaagaacgat
accattgtgaatgagttagtacacgtggccaaggagggagctgacctacagctgaggaag
gtgaccgtcttgggagtagccacagcccctacacaagtcctttccaatggtgtccctgtc
tccaatttcacctacagccctgaaagcaagatcctggccatccctgtctcactgctcatg
ggagagcagtttcagattgactggtcctag

KEGG   Cricetulus griseus (Chinese hamster): 100769016Help
Entry
100769016         CDS       T02813                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC100769016 isoform X2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
cge04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100769016
   00500 Starch and sucrose metabolism
    100769016
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100769016
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100769016
    3.2.1.20  alpha-glucosidase
     100769016
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 M157
Motif
Other DBs
NCBI-GeneID: 100769016
NCBI-ProteinID: XP_027245489
LinkDB All DBs
Position
1
AA seq 4557 aa AA seqDB search
MARPRFKKFSKLELTLIVLLLVLFIIAVVLIVLLANSTPQNDPGTTGTPHSTTPRISTPD
TTVLRTSTPDSTSRTTPSHCPVLSEQERINCIPDKSPNKTICDQRGCCWDPQGAGNAICY
FSKNHGYQMESDPVITNAGLTAQLKNLPSAPLFGSEIENVLLTAEYQTPNRFHFKFTDPT
KDRYEVPHEHVQPFSGNAASSLNYRVEVFKQPFSIKVTRKSNNRVLLDTSIGPLLFSDQF
LQLSTYLPSANVYGLGEHVHQRYRHDMNWKTWPLFSRDTTPNKDGNNLYGVQTFFLCLED
NSGLSFGVFLMNSNAMEVTLQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPA
LPSYWALGFQLSRYDYGSLDNMKAVVDRNRAVQLPYDVQHADIDYMDQRKDFTYDPVKFS
GFPEFAEDLHLNRQKLIIILDPAISNNSFPDDPYDPYDKGSAMNIWVNSSDGINPLIGEV
WPGITVFPDYTNPNCAVWWAEEINSFHNKVKFDGIWIDMNEVSNFVDGSVSGCSTNDLNY
PPFTPKILDGHLFSKTLCMDAVQYWGRQYDVHSLYGYSMAIATSEAVKATFPEKRSFIIT
RSTFAGSGKFAAHWLGDNSATWEDLQWSVPGMLEFNLFGIPMVGADICGFALNTTEELCR
RWMQLGAFYPFSRNHNGQGYKDQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLLYHAH
SRGDTVARPLLHEFYKDNNTWDIDRQFLWGPGLLITPVLEEASEKVKAYLPDAIWYDYET
GAQVTWRKQSIDMELPGDKIGLHLRGGYIFPTQQPDTTTADSRKNPLGLIIALDENKEAR
GELFWDDGETKDTVTKNTYIFSEFSVTQNHLNVTISSASYKDPNNLEFQEIKILGTQAIY
NVKVKQNGVLSSMSPQITYNSNLKVATITDLHLVLGEPYTVEWSNMTDEEKIDCYPDEHG
ASEANCTARGCIWEESDTPGVPYCFFANGLYSVTDVQYQPDGVTANISLKDSPYTELYSV
RSVQYRSNEATANVSLKDSPYSNAFPSTPVKQLQVQVIYHKNEMLQFKIYDPNDSRYEVP
VPLNIPISPSSTTDGRLYDVLIKENPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTR
LPSTHIYGFGETEHTSFKIDLNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGV
LLLNSNAMDVTFQPLPALTYRTTGGILDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLG
FQLCRYGYENDSEIASLYDEMVAKQIPYDVQYSDIDYMERQLDFTLSPKFSGLPDLISRM
KKDGMRVILILDPAISGNETEPYPAFTRGLQEDVFIRYPNGGDIVWGKVWPDYPGIVVNS
SLDWDSQVEQYRAYVAFPDFFRNSTVTWWKKEIEELHTNPQNSTKSLKFDGLWIDMNEPS
SFVNGAVPPGCSDATLNRPPYMPHLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHSLY
GWSQTRPTYEAVQEVTGERGIVITRSTFPSSGRWAGHWLGDNTAAWDQLGKSIIGMMEFS
LFGISYTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDEAFEDIS
RSVLETRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFLSDRETWNIDKQFLLGSSFLVSPV
LEPNARNVTAYFPKAHWYDYYTGADINSTGEWKTLPAPLEHINLHIRGGSILPWQKHALN
THLSRMNPLGLLIALDENKEARGELFWDDGKSKDTVTKNTYIFSEFSVTQNHLNVTISSA
SYKDPNNLEFQEVKIFGTEEIFNVRVKQNGVLSQMSPQVTYNSTLKVATITDLHLVLGEP
YAIHWSTKRDQEKIDCYPDEHGASEANCTARGCIWEESDTPGVPYCFFASDLYSVSNVQY
HQNEATADISLKDSPYSNAFPSTPVKQLQVQVIYHKNEMLQFKIYDPNDSRYEVPVPLNI
PISPSSTTDGRLYDVLIKENPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSTH
IYGFGETEHTSFKIDLNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLLNS
NAMDVTFQPLPALTYRTTGGILDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCR
YGYENDTEIASLYDEMVAKQIPYDVQYSDIDYMERQLDFTLSPKFSGLPDLINRMKRDGM
RVILILDPAISGNETEPYPAFTRGLQEDVFIRYPNGGDIVWGKVWPDYPGIVVNSSLDWD
SQVELYRAYVAFPDFFRNSTVTWWKKEIEELHTNQQNPTKSLKFDGLWIDMNEPSSFVNG
AVPPGCSDATLNRPPYMPHLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQT
RPTYEAVQEVTGERGIVITRSTFPSSGQWAGHWLGDNTAAWDQLGKSIIGMMEFSLFGIS
YTGSDICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDEAFEDISRSVLE
TRYTLLPYLYTLMYKAHTEGSTVVRPLLHEFVSDKETWNIDKQFLLGPAFLISPVLEPNA
RNVSAYFPTALWYDYYTGVAINSTGEWKTLAAPLEHINLHVRGGYILPWQRPALNTHLSR
MNPLGLLIALDENKEARGELFWDDGKSKDLTTNNILCKFSVTQNHLDVSAVGSTFSNPDD
LAFQEIKIFGTQVLHNVTVKHNGVTSQMSPQVTYDPNMKVAVITGIQLLLNESYTVEWED
SIKDEEKMDCYPDQTGASEASCAARGCIWKESNTPGVPYCYFVNDLYSVSNVQHLEKEAT
ANISLKNSPYSNAFPSTPVKQLQLSVVYHKNEMLQFKIYDPNHSRYEVPVPLNIPSSPSS
TTDGRLYDVLIKENPFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSTHIYGFGE
TEHTSFKIDLNWHTWGMFSRDEPPGYKKNSYGVHPYYMGLEEDGNAHGVLLLNSNAMDVT
FQPTPALTYRTTGGVLDFYVFLGPTPELVTQQYTELIGRPVMVPYWSLGFQLCRYGYEND
TEIASLYDEMVAKQIPYDVQYSDIDYMERQLDFTLSPKFSGLPDLINRMKRDGMRVILIL
DPAISGNETEPYPAFTRGLQEDVFIRYPNGGDIVWGKVWPDYPGIVVNSSLDWDSQVEQY
RAYVAFPDFFRNSTVTWWKKEIEELHTNPQNPTKSLKFDGLWIDMNEPSSFVNGAVPPGC
SDATLNRPPYMPHLEARDRGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYVA
VQEVTGERGIVITRSTFPSSGRWAGHWLGDNTAAWNQLGKSIIGMMEFSLFGISYTGSDI
CGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVSWDEAFEDISRSVLETRYTLL
PYLYTLMYKAHTEGSTVVRPLLHEFVADRETWNIDRQFLLGPAFLISPVLEPNARTVDAY
FPRARWYDYYTGADINARGQWKTLPAPLEHINLHVRGGYILPWQEPAMNTHLSRKNPLGL
IVALDYKREAKGQLYWDDGVSKGTVLERKYILYDFSVTSNHLQAKIINNNYVDPNDLMFT
DIRILGMDKEPTGLNVLFNNNAIPILSYNYNASTKVLVIDNLTGLKLGQEFTIEWTLLVS
DLEKFNCFPEDPAASEESCKQRGCLWEVMTTLTRELXTFCPKSIPQYAASNIQYQPTGIT
MDLTLLADSASARAAAAPSIVSDPLSGKISSLKLHVTYHTENMLQVKIYSSSNKRYEVPI
PLNIPSSALGSSENCLYDVTVKTNPFGLEIRRKNSGTVIWDSQLPGFTFSEMFLSISTRL
PSQYIYGFGETEHESFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYMALEDDGNAHGVL
LLNSNAMDVTLQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTQLIGRPAMTPYWALGF
QLSRYGYQSDDEIANLYDAMVAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLSVLINQMK
TNGMRFILILDPAISGNETQYLPFTRGQENNVFIKWPDSNDIVWGKVWPDLPNVNVDGSL
DQESQVKLYRAYVAFPDFLRNSTAAWWKKEIGEIYSNPREPKKSLKFDGLRIDMNEPSNF
VDGSVKGCRNEILNKPPYMPYLEARDRGLSSKTLCMESEQILPDDSRVQHYDVHSLYGWS
QTRPTYEAVQEVTGERGIVITRSTFPSSGHWAGHWLGDNTAAWDQLGKSIIGMMEFSLFG
IPYTGADICGFFGDAEYEMCIRWMQLGAFYPFSRNHNNAGTRRQDPVAWNSTFEEYSRKV
LRIRYSLLPYLYTLMHKAHTEGSTVIRSLLHEFTDDNITWDIDQQFMLGPAILISPVLQS
NTFKIHAYFPRARWYDHSTGSGQESMGEWRLLAAPLDHINLHVRGGYILPWQEPAINTYY
SRKNFVGLTVALDDEGKAEGQLFWDDGQSIDTYEKGNYFLANFIATQNTLKIQVLHNQYL
SGSNQLKIGYIRLWGLNSSYVVHVAFTYNNQQFIENNFTTDPYNQAVLVGDSNKVKK
NT seq 13674 nt NT seq  +upstreamnt  +downstreamnt
atggcgagaccaaggtttaaaaagttcagcaaattggagcttacactcattgtcctgctg
cttgtgttgttcatcatcgctgtggttctgattgtgctcttagccaattctacaccgcaa
aatgatcctggcacaactggcaccccacactctacaaccccaagaattagcactccagac
actacagtcctaagaactagcacgccagactctacctcaagaaccactccttcccactgc
ccagttctaagtgaacaggaacggataaattgcatccctgacaagtcacctaacaagacc
atatgtgaccagcgtggctgctgctgggatccccagggagcgggaaatgctatttgctac
ttttccaagaatcatggctaccaaatggagagtgatcctgtgattacaaatgcaggactc
acggctcagttgaaaaacttgccctctgcacccctgtttggaagtgaaattgaaaatgtc
ttgctcacggcggagtaccagacaccgaatcgcttccattttaagtttactgacccaacc
aaggacaggtatgaagtccctcatgaacatgtgcaacccttcagtggaaacgctgcttct
tccttgaactaccgagttgaggtctttaaacaaccatttagcatcaaagtcaccagaaaa
agcaacaaccgtgtgctgcttgacacaagtattgggcctctcctcttctctgaccagttc
ctgcaactctcaacctaccttccaagtgctaatgtgtacggtctgggagagcacgtgcac
caacggtacaggcatgacatgaactggaagacctggcccttgttttccagggacacaacc
cccaataaggatggaaataacttgtatggtgtgcagaccttcttcctgtgccttgaagac
aatagtggattatcctttggggtgtttctgatgaacagcaatgccatggaggttaccctt
cagcccaccccagcaatcacataccgcaccattgggggaattctggacttctatgtgttc
ttggggaacacacccgaacaagttgttcaagaatatctagagctcattgggcggccagct
ctgccttcatactgggcacttgggtttcagctcagccggtatgactatggaagcctagac
aatatgaaagcagttgtggacaggaaccgtgcagtacaactcccttacgatgttcagcat
gctgatattgattatatggatcagaggaaggatttcacttatgacccagtgaagttttca
ggcttcccggagtttgctgaggacttacaccttaataggcagaaacttattatcattttg
gatccggccatttctaacaactctttcccagatgatccctatgacccatatgataaaggt
tcagcaatgaatatctgggtgaatagttctgatggcataaacccactcattggagaggtc
tggcctggaataactgtgtttcctgattacaccaatcccaactgtgctgtttggtgggca
gaggaaattaatagtttccacaataaagtgaaatttgatggaatttggattgatatgaac
gaagtctccaactttgttgatggctcagtttcaggatgttccacaaatgacctcaattat
cctcctttcacaccaaagatcctggatgggcacttgttctctaagactctctgcatggat
gctgttcagtactggggcaggcagtatgacgtccacagtctgtatggctactccatggcc
attgccacatcagaagccgtgaaggctacatttccagagaagagaagcttcatcatcaca
cggtccacctttgcgggatctggcaagtttgcagcccactggttaggagacaactcggcc
acctgggaggaccttcagtggtctgttccaggcatgcttgagttcaaccttttcggcatc
ccaatggtaggggctgacatatgtggctttgccttgaacacgactgaggagctctgcagg
cggtggatgcagctgggggcattttatccattttcccggaatcacaatggccagggctac
aaggaccaggatccggcctcttttggagcagattccttgctcttgaattcgtctaggcac
taccttaacatccgatacactctgctgccttacctctacactcttttataccacgcccac
agccggggagacaccgtggctaggccccttctgcatgagttctataaggacaacaatact
tgggacatagaccggcagtttctgtggggaccaggcctcctcatcactcctgttctggaa
gaggcaagtgagaaagtgaaggcatatctgcctgatgccatctggtatgactatgagacg
ggggcgcaagtgacatggagaaagcaaagcattgacatggaacttcctggagataaaatt
ggacttcaccttcgaggaggctacatcttccccacacaacagccagacacaaccacagca
gacagccggaagaaccctcttggtctgatcattgcgctggatgagaacaaagaagcccga
ggagaactgttctgggatgatggagagacaaaggatactgtgaccaagaacacttacatt
ttcagtgaattttctgtcacccaaaaccatttgaatgtgacaatttcaagtgcaagctac
aaggatcccaataacttagaattccaggaaattaaaatccttgggacacaggcaatttac
aatgttaaagtgaaacagaatggtgtccttagttcaatgtctcctcaaatcacttacaat
tcaaacctgaaggttgccaccatcacagatctccatctcgtgctgggagaaccatacact
gtcgagtggagtaacatgacagacgaggagaagatagactgctatccagatgagcatgga
gcttctgaggccaactgcactgcccggggctgcatctgggaggaatcggacactcctggg
gttccttattgcttctttgccaatggcctgtactcagtcaccgatgtccagtatcaacct
gacggggtcacagccaacatttccttgaaggattctccttataccgagctgtactcggtc
aggagtgtacagtatcgctcaaatgaggccacagccaatgtctccttgaaggattctcct
tatagcaacgccttcccctctacacccgtgaagcaactgcaagtgcaagtgatctaccac
aagaatgaaatgctgcagttcaagatctacgatcccaacgacagtcggtatgaagtccca
gtgcctctgaatatccccatttctccatccagcacaactgacggccgtctctacgatgtc
ctcatcaaggagaatccatttgggattgaaattcgcaggaagagtacaggcactgtgatc
tgggactctcagctccttggcttcaccttcaatgacatgtttatccgcatctccacccgc
ctgccctccacacacatctatggctttggggaaactgagcacacaagcttcaagatagac
ctgaactggcacacgtggggcatgttttccagggacgagcccccggggtacaagaagaat
tcctatggtgtccatccttactacatggggctagaggaggatggcaatgcccacggagtc
ctcctgctgaacagcaatgccatggatgtgacattccaacccctgcctgcactaacatac
agaaccacagggggcattctggacttctatgtgttcttgggcccaactccagagcttgtc
actcagcaatacacagagttgattggtcggccagtgatggtaccttactggtccctggga
ttccagctgtgtcgctatggatatgagaatgactctgagatcgccagcttgtatgatgag
atggtggctaagcagatcccctatgacgtgcagtactcagacatcgactacatggagagg
cagctggacttcaccctcagccccaagttctctgggctcccagacctgatcagtcgcatg
aagaaagatgggatgcgggtcatcctcattctggacccagctatttctggcaatgagaca
gagccctatcctgccttcacccgaggtctacaggaggacgtctttatcagatatcccaat
ggtggagacattgtctggggaaaggtctggcctgattaccctggtattgtggtgaacagt
tctctagactgggacagtcaagtggagcaataccgagcttatgtggccttcccagacttt
ttccgtaattcaactgtcacgtggtggaagaaggagattgaagaactccacacaaaccca
cagaattcaaccaagagcttgaagtttgatggcctgtggattgatatgaatgaaccttcc
agctttgtaaatggggcagttcctccaggctgcagcgatgctaccctgaaccgtcctccc
tacatgccacatttggaagccagggacaggggcctgagcagcaagactctgtgcatggag
agtgagcagatccttccagatggctcccgggtgcggcactatgatgtgcacagcctgtat
gggtggtcccagaccagacccacctatgaagctgttcaggaggtgacaggagagagaggg
attgtcatcacacgctccacattcccctcttctggacgctgggcaggacactggctggga
gacaacacagctgcctgggaccagctggggaagtccatcattggcatgatggagttcagt
ctctttggcatctcctataccgggtcagacatctgtgggttctttcaagatgctgagtat
gagatgtgtgttcgctggatgcagctgggagccttttaccccttctccaggaaccacaac
accattgggaccaggagacaagaccctgtatcctgggatgaagcctttgaggatatttcc
agaagtgtgctggagaccagatacaccctgttgccatatctctacaccttgatgtacaag
gcccacacggagggcagcaccgttgtgcggcctcttctccacgagtttctgtccgaccgg
gagacatggaatatagacaaacagttcctgctgggttcatccttcctggtcagccccgtg
ctggagcccaatgccagaaatgtcactgcctatttccccaaagcccactggtatgactat
tacacgggtgcagatattaattcaacaggagagtggaagacattgccagcccctctggag
cacattaaccttcacatccggggaggttccatcttgccatggcagaagcatgccctgaac
actcacttaagccggatgaaccctcttggtcttctcattgccctggatgagaacaaagaa
gcacgaggagaactgttctgggatgatgggaagtcaaaggatactgtgaccaagaacact
tacattttcagtgaattttctgtcacccaaaaccatttgaatgtgacaatttcaagtgca
agctacaaggatcccaataacttagaattccaggaagttaaaatctttgggacagaggaa
attttcaatgttagagtgaaacagaatggtgtccttagtcaaatgtctcctcaagtcact
tacaactcaactctgaaggttgccaccatcacagatctccatctcgtgctgggagaacca
tacgccatccactggagcaccaagagggaccaggagaagatagactgctatccagacgag
catggagcttctgaggccaactgcactgcccgtggctgcatctgggaggaatcggacact
cctggggttccttattgcttctttgccagtgacctgtactcagtcagcaatgttcagtat
caccagaacgaggccacagctgacatttccttgaaggattctccttatagcaacgccttc
ccctctacacccgtgaagcaactgcaagtgcaagtgatctaccacaagaatgaaatgctg
cagttcaagatctacgatcccaacgacagtcggtatgaagtcccagtgcctctgaatatc
cccatttctccatccagcacaactgacggccgtctctacgatgtcctcatcaaggagaat
ccatttgggattgaaattcgcaggaagagtacaggcactgtgatctgggactctcagctc
cttggcttcaccttcaatgacatgtttatccgcatctccacccgcctgccctccacacac
atctatggctttggggaaactgagcacacaagcttcaagatagacctgaactggcacacg
tggggcatgttttccagggacgagcccccggggtacaagaagaattcctatggtgtccat
ccttactacatggggctagaggaggatggcaatgcccacggagtcctcctgctgaacagc
aatgccatggatgtgacattccaacccctgcctgcgctaacatacagaaccacagggggc
attctggacttctatgtgttcttgggcccaactccagagcttgtcactcagcaatacaca
gagttgattggtcggccagtgatggtaccttactggtccctgggattccagctgtgtcgc
tatggatatgagaatgacactgagatcgccagcttgtatgatgagatggtggctaagcag
atcccctatgacgtgcagtactcagacattgactacatggagaggcagctggacttcacc
ctcagccccaagttctctgggctcccagacctgatcaatcgcatgaagagagatgggatg
cgggtcatcctcattctggacccagctatttctggcaatgagacagagccctatcctgcc
ttcacccgaggtctacaggaggacgtctttatcagatatcccaatggtggagacattgtc
tggggaaaggtgtggcctgattaccctggtattgtggtgaacagctctctagactgggac
agtcaagtggagctatatcgagcttatgtggccttcccagactttttccgtaattcaact
gtcacgtggtggaagaaggagattgaagaactccacacaaaccaacagaatccaaccaag
agcttgaagtttgatggcctgtggattgatatgaatgaaccttccagctttgtgaatggg
gcagttcctccaggctgcagcgatgctaccctgaaccgtcctccctacatgccacatttg
gaagccagggacaggggcctgagcagcaagactctgtgcatggagagtgagcagatcctt
ccagatggctcccgggtgcggcactatgatgtgcacagcctgtatgggtggtcccagacc
agacccacctatgaagctgttcaggaggtgacaggagagagagggattgtcatcacacgc
tccacattcccctcttctggacaatgggcaggacactggctgggagataacacagctgcc
tgggaccagctggggaaatccatcattggcatgatggagttcagtctctttggcatctcc
tataccgggtcagacatctgtgggttctttcaagatgctgagtatgagatgtgtgttcgc
tggatgcagctgggagccttttaccccttctccaggaaccacaacaccattgggaccagg
agacaagaccctgtatcctgggatgaagcctttgaggatatttccagaagtgtgctggag
accagatacaccctgttgccatatctctacaccttgatgtacaaggcccacacggaaggc
agcacagttgtgcggcctcttctccacgaatttgtgtcagacaaagagacctggaatata
gacaaacagttcctcctcggtccagccttcctgatcagccctgttctggagcccaatgct
cgaaacgtcagcgcgtacttccccacagccctctggtatgactactacacgggtgtagct
atcaattcaacaggagagtggaagaccttagcagcccctcttgagcacatcaatcttcat
gtccgtgggggctacatcctgccgtggcaacgacctgccctgaacactcacttaagccgg
atgaaccctcttggtcttctcattgccctggatgagaacaaagaagcacgaggagaactg
ttctgggatgatgggaagtcaaaggatctcacaaccaataacattctatgtaaattttca
gtcactcaaaaccacttggacgtgagtgccgtaggatcaaccttctcgaaccctgatgat
ttagcatttcaggagattaaaatttttggaacacaggtgcttcacaatgttacagtgaaa
cacaatggtgtcacaagtcagatgtcccctcaggtcacttatgatcctaacatgaaggtt
gcagttatcacgggcatccaacttctgctcaatgaatcatacacggtggagtgggaagac
agcataaaggatgaggaaaagatggactgttatcccgatcaaactggggcttccgaggca
agctgcgctgcccgaggctgtatctggaaggaatccaacactcctggggtcccttattgc
tactttgtcaatgacctgtactcagtcagcaatgttcagcatcttgagaaggaggccaca
gccaacatctccttgaagaattctccttatagcaacgccttcccgtctacacccgtgaag
caactgcaactgagcgtggtctaccacaagaatgaaatgctgcagtttaagatctacgat
cccaaccacagtcggtatgaagtcccagtgcctctgaatatccccagttctccgtccagc
acaactgacggccgtctctacgatgtcctcatcaaggagaatccatttgggatagaaatt
cgcaggaagagtacaggcactgtgatctgggactctcagctccttggcttcaccttcaat
gacatgtttatccgcatctccacccgcctgccctccacacacatctatggctttggggaa
actgagcacacaagcttcaagatagacctgaactggcacacgtggggcatgttttccagg
gacgagcccccggggtacaagaagaattcctatggtgtccatccttactacatggggcta
gaggaggatggcaatgcccacggagtcctcctgctgaacagcaatgccatggacgtgacg
ttccagcccacgcctgctctcacataccgcaccacggggggagttttggatttttatgta
tttttggggccaactcccgaacttgtcactcagcagtacacagagttgattggtcggcca
gtgatggtaccttactggtccctgggattccagctgtgtcgctatggatatgagaatgac
actgagatcgccagcttgtatgatgagatggtggctaagcagatcccctatgacgtgcag
tactcagacatcgactacatggagaggcagctggacttcaccctcagccccaagttctct
gggctcccagacctgatcaatcgcatgaagagagatgggatgcgggtcatcctcattctg
gacccagctatttctggcaatgagacagagccctatcctgccttcacccgaggtctacag
gaggacgtctttatcagatatcccaatggtggagacattgtctggggaaaggtctggcct
gattaccctggtattgtggtgaacagttctctagactgggacagtcaagtggagcaatac
agagcttatgtggccttcccagactttttccgtaattcaactgtcacgtggtggaagaag
gagattgaagaactccacacaaacccacagaatccaaccaagagcttgaagtttgatggc
ctgtggattgatatgaatgaaccctccagctttgtgaatggggcagttcctccaggctgc
agcgatgctactctgaaccgtcctccctacatgccacatttggaagccagggacaggggc
ctgagcagcaagactctgtgcatggagagtgagcagatccttccagatggctcccgggtg
cggcactatgatgtgcacagcctgtatgggtggtcccagaccagacccacctacgtagct
gttcaggaggtgacaggagagagagggattgtcatcacacgctccacattcccctcttct
ggacgctgggcaggacactggctgggagacaacacagctgcctggaaccagctggggaag
tccatcattggcatgatggagttcagtctctttggcatctcctatactgggtcagatatc
tgtgggttctttcaagatgctgagtatgagatgtgtgttcgctggatgcagctgggagcc
ttttaccccttctccaggaaccacaacaccattgggaccaggagacaagaccctgtatcc
tgggatgaagcctttgaggatatttccagaagtgtgctggagaccagatacaccctgttg
ccatatctctacaccttgatgtacaaggcccacacggagggcagcacagttgtgcggcct
cttctccatgagtttgtggcagaccgggagacctggaatatagacagacagttcctgctg
ggtccagccttcctcatcagccctgtgctggagccaaatgccagaactgtagatgcatat
tttcccagagcccgctggtatgactactacacaggtgcagatattaatgcaaggggacaa
tggaagaccttgccagcacctcttgagcacattaaccttcatgtccgtgggggctacatc
ctgccctggcaggagcctgccatgaacacccatctgagccggaagaatcccttgggactc
atcgttgccttggactacaagcgagaagcaaagggccagttgtactgggatgatggtgtg
tctaaaggcactgtgttagaaaggaagtacattctgtatgatttttctgtgacatccaat
catttacaggcaaaaataataaataataattacgtggatcccaatgatctcatgttcacc
gacatcagaatcttgggaatggataaagagccaactggtcttaatgtcttatttaataac
aatgccatccccattttaagctacaactacaatgcttcaacaaaggtgttggtcatcgat
aatctcacaggactgaaactgggacaagaattcaccattgagtggactcttctggtcagt
gacctggagaagtttaactgcttccccgaggatcctgcagcatctgaggaaagctgcaaa
cagcgcgggtgcctttgggaggtaatgaccacactgaccagggagttgtagacattttgc
cccaagtccattccccagtacgctgccagtaacattcagtaccagcccacaggtatcacc
atggacctgaccctcctggcagactcagcatctgcccgggcagcagcagctccaagcatt
gtttctgatcctctttctggaaagatcagctctcttaaactgcatgtgacctaccataca
gaaaacatgctgcaggtcaagatttatagttcctctaacaagagatatgaggttccaata
cctctcaacatcccttcttcggcgcttggatcctctgagaactgcctgtatgatgtcaca
gttaaaaccaacccatttggacttgaaattagacggaaaaactccggtactgtgatttgg
gattcccaactccctggcttcaccttcagtgagatgtttctttccatttcaactcgcctt
ccatctcagtacatctatggcttcggggaaacagagcatgaatctttcagaagaaacatg
agctggaacatgtggggaatgtttgctcgggatgaacccccagcgtacaagaagaattcc
tatggtgttcacccttactatatggcattggaagatgatggcaatgcccatggagtgctc
ctgttgaacagcaatgccatggatgtgacattgcagcctaccccggccctgacataccga
accataggagggattctggacttctatatggttctggggccaacacctgagcttgtaact
cagcaatacacacagttgattggtcgacccgccatgactccatactgggctttaggtttc
cagctgagtcgctacggataccagagtgatgatgaaattgccaatttgtatgatgcaatg
gtggcagcccagattccctatgatgtccagcatgtagacattgattacatggaccggaag
ttggacttcaccctcagccccagctttcagaatctcagtgtcctgattaatcaaatgaag
acaaatggcatgaggtttattctcattctggacccggccatttctggcaacgagacacaa
tatctaccatttactcgaggacaagaaaacaatgtgttcatcaaatggcctgactccaac
gacattgtctggggcaaggtttggccagatttgcccaatgtaaatgtggatggatccctt
gaccaagagtctcaagttaagctatacagggcctatgttgcctttcctgacttcctgcgc
aacagcacggctgcatggtggaagaaagagataggggagatctattcaaatccccgggag
ccaaagaagagcttgaagtttgatgggctgcggattgacatgaatgagccttcaaacttt
gtggatggatctgtcaagggctgccgcaacgaaattctcaacaagcctccctacatgcca
tatttggaagccagggacaggggcctgagcagcaagactctgtgcatggagagtgagcag
atccttccagatgactcccgggtgcagcactatgatgtgcacagcctgtatgggtggtcc
cagaccagacccacctatgaagctgttcaggaggtgacaggagagagagggattgtcatc
acacgctccacattcccctcttctggacactgggcaggacactggctgggagacaacaca
gctgcctgggaccagctggggaaatccatcattggcatgatggagttcagtctctttgga
ataccttatacaggagctgacatctgtgggttctttggagatgctgagtatgagatgtgt
atccgctggatgcaactgggagcattttatccattttccaggaaccacaacaatgccggg
actaggagacaagatcccgtggcctggaattcgacttttgaggagtactcaaggaaagtg
ttgcggatcagatactccctgctgccctatttatataccctgatgcataaagctcacact
gagggcagcaccgtcatcagatcgcttctccatgagttcacagacgacaatataacatgg
gacatagaccaacagttcatgttgggcccggctatcctgatcagccccgttctgcagagt
aatacatttaagatccatgcttatttccccagagcccggtggtatgatcatagcacggga
tctgggcaggaatcaatgggtgagtggaggttactggcagcccctctggaccacatcaac
cttcatgtcagaggaggctacattctgccttggcaggagcctgcaataaacacctactac
agtcgaaaaaattttgtgggattgactgtagctttggatgatgaagggaaggcagaagga
cagttgttttgggatgatggacaaagcatcgatacatatgagaagggaaattatttctta
gctaactttatagcaacacagaacaccctgaagatccaggtcctacataatcagtacctg
agtggctcaaatcaactgaaaattggatacattagactatggggtttaaattcttcttat
gtggtacatgtcgcttttacctacaacaaccagcaattcattgagaacaatttcacaact
gacccctacaatcaggcagtattagtgggtgacagtaataaggtcaagaaatga

KEGG   Cricetulus griseus (Chinese hamster): 100770033Help
Entry
100770033         CDS       T02813                                 

Gene name
Ganc
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100770033 (Ganc)
   00500 Starch and sucrose metabolism
    100770033 (Ganc)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100770033 (Ganc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100770033
NCBI-ProteinID: XP_027277918
LinkDB All DBs
Position
6
AA seq 915 aa AA seqDB search
MEAAEKEEISVEDEAVDKTIFRDCSEIAFYRRQKQQLSKNTTYQALLDSVTTEQDSTRFQ
IISEANKTPLLVEVYGIEKNIFRLKINEETPLKPRYEVPDVITSKLRTVRLVSCPGDAGS
LILTDGKGDLKCHISANPFKVDLVSENEAVISINSLGQLYFEHLQIPHKQSRATKGNQES
APADTSQENQEDLGLWEEKFGKFVDVKANGPSSIGLDFSFHGFEHLYGIPQHAESHQLKN
TRDGDAYRLYNLDVYGYQIHDKMGIYGSVPYLLAHKQGKTVAIFWLNASETLVEINTEPA
VEYTLTQTGAAAAKQKVRCRTDVRWMSESGIIDVFLLTGPTPSDIFKQYSSLTGTQAMPP
LFSLGYHQCRWNYEDEQDVKAVDAGFDEHGIPYDVMWLDIEHTEDKKYFTWDKKRFANPR
RMQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKEQGFFVKNPEGGDFEGVCWPGLSSYL
DFTNPKVREWYSGLFAFPVYQGSTDILFIWNDMNEPSVFRGPELTMQKNAVHYGNWEHRE
LHNMYGFYQQMATAEGLIRRSKGQERPFVLSRSFFAGSQKYGAVWTGDNAAEWNYLKISI
PMLLTLSVSGISFCGADVGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFG
EEYTRLIREAIRERYTLLPYLYSLFYRVHMSSEPVMRPLWVEFPDDLETFSVDDEYMLGS
ALLVHPITEPQTTMADIFLPGSNEVWYDSKTFAQWKGGCTVKIPVTLDTIPVFQRGGSVV
PIKTSVGKSTGWMTDSPYGLRLALSTQDSAEGELYLDDGHSFQYLHQDQFLHRRFSFCSG
VLINRCADEKGHYPSKCIVEQILVLGLRKKPSSVTTRSSDGKVQPAAFTYHTKASALSLE
KLSLSITDDWEVHIR
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaccatt
ttcagagactgtagtgagattgctttctacaggcggcagaaacagcagctctccaagaat
accacctatcaggcattgttagactcagtcacaacagaacaggacagcaccaggttccaa
atcatcagtgaagcaaataagactcctctcctggttgaagtttatggcatagagaaaaac
attttcagacttaaaattaatgaagaaactccactgaaaccaaggtatgaggttcctgac
gtcatcaccagcaagctaagaactgtaaggctggtctcatgcccaggggatgctggcagc
ctgatactgacagatggcaaaggagatctgaagtgtcacatctcagcaaacccattcaag
gtagacttggtgtctgagaacgaggctgtgatcagcatcaactccctgggccagttatac
tttgagcacctacagattcctcacaagcaaagcagagctaccaaagggaaccaggagagc
gcaccagccgacacctctcaggaaaatcaagaagacctaggcctgtgggaagagaaattt
ggaaaatttgtggatgtcaaagctaatggtccttcctctattggtttggatttctccttt
catggatttgaacatctctatggtatccctcaacatgcagaatcacaccaacttaaaaac
actagggatggagatgcataccgcctttataacctagatgtctatggatatcaaatacat
gacaaaatgggcatttatggttcagtgccttatctcctggcgcacaaacagggcaagact
gtagccattttctggctaaatgcctcggaaacactagtggagatcaacacagagccagca
gttgagtacacgctaacccagacgggcgctgcagctgccaaacaaaaggtcaggtgtcga
actgatgtgcgctggatgtcagagagtggaatcattgatgtttttctgctgacaggacct
acaccttctgacatcttcaagcagtactcatccctcacaggcacacaagccatgccccct
cttttttccctggggtaccaccagtgccgctggaactatgaagatgagcaggatgtgaag
gcagtggatgcaggttttgatgagcatggcattccatatgacgtcatgtggctggacata
gagcacactgaggacaagaaatacttcacctgggacaaaaagaggttcgcaaaccccaga
agaatgcaagagctactcaggagcaaaaaacgcaagcttgtggttatcagtgacccccac
atcaaggtggatcctgactactcagtctatgccaaagccaaagaacagggcttctttgtg
aagaatccagaaggtggcgactttgaaggagtatgttggcctggtctctcatcttacctg
gatttcaccaatcccaaggtcagagagtggtattccggcctttttgcttttcctgtgtat
cagggatctacagacatcctcttcatatggaatgacatgaatgagccctcagtcttcaga
gggccagagctaaccatgcaaaagaatgctgttcattatggcaattgggagcacagggaa
cttcacaacatgtatggattttatcagcaaatggctactgcagaaggactgatacggcga
tctaaagggcaggagagaccctttgttctttcacgttctttctttgctggatcacaaaag
tatggtgcagtatggacaggagacaatgcagcagaatggaactatctgaaaatttccatc
ccaatgttactcaccctcagtgtctccgggatctctttctgtggagctgatgtgggtggc
ttcattggcaatccagagacagagctgctggtgcgttggtaccaggctggagcttaccag
ccctttttccgtggccacgctaccatgaacaccaagcgtcgagaaccctggctgtttggg
gaagaatacactcggctgatccgggaagctatcagagagcgctacaccctcctaccctat
ctgtattctctgttttaccgtgtgcacatgtcttctgaacctgttatgaggcctctgtgg
gtcgagttccctgatgacttagagactttcagtgtggatgatgaatacatgctgggaagt
gctttattggttcatccaatcacagagccacagaccaccatggctgatatattcctgcca
gggtcaaatgaggtctggtatgactctaagacatttgcacagtggaaaggagggtgcact
gtgaagattccagtaaccttggatactataccagtgtttcaacgaggcggaagtgtggta
ccaataaagaccagtgtgggcaagtccacaggctggatgactgactccccatatggactc
cggcttgctctaagcactcaggactctgctgagggagagctgtatcttgatgacggccat
tcattccagtacctccaccaggaccagttcttacaccgcaggttttcattctgttccggt
gttctgatcaacaggtgtgctgatgagaagggtcattatcccagcaagtgcatagtggag
caaatcttggtcttaggccttaggaagaagccatcttctgtgactacccgctcatctgat
ggtaaggttcagcctgcagcttttacataccacactaaagcatcggccctaagtctggag
aagctttccctcagcattaccgatgactgggaggtccatatcagatga

DBGET integrated database retrieval system