KEGG   Cricetulus griseus (Chinese hamster): 100755179Help
Entry
100755179         CDS       T02813                                 

Gene name
Aldob
Definition
(RefSeq) fructose-bisphosphate aldolase B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge04066  HIF-1 signaling pathway
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100755179 (Aldob)
   00030 Pentose phosphate pathway
    100755179 (Aldob)
   00051 Fructose and mannose metabolism
    100755179 (Aldob)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100755179 (Aldob)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100755179 (Aldob)
   03036 Chromosome and associated proteins [BR:cge03036]
    100755179 (Aldob)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100755179 (Aldob)
Enzymes [BR:cge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     100755179 (Aldob)
Membrane trafficking [BR:cge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100755179 (Aldob)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100755179 (Aldob)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100755179 (Aldob)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 100755179
NCBI-ProteinID: XP_027258902
LinkDB All DBs
Position
2
AA seq 364 aa AA seqDB search
MAYRFPALTSEQKKELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
ELLFTVDNSVNQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGSAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVLPDGDHDLEYCQYVSEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
SKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINRCPLPKPWKLSF
SYGRALQASALAAWGGKAENKKATQEAFMKRALANCQAAQGKYVHTGSSGAAATQSLFTA
SYTY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccgatttccagccctcacctcagagcagaagaaggagctctcagagattgcc
caacgtattgttgccaacggaaagggcatcctggctgcagacgaatctgtaggcaccatg
ggaaaccgcctacagaggataaaagtggaaaatactgaagagaaccgcaggcagttccga
gaactcctctttactgttgacaattccgtcaaccagagcatcgggggagtgatccttttc
catgagaccctctaccagaaggacagccagggaaagctgttcagaaacattctcaaggag
aagggaattgtggtgggcatcaagttggaccaaggaagtgctccccttgcaggaacaaac
aaagaaaccaccattcaaggacttgatggcctctctgaacgctgtgctcagtacaagaaa
gatggtgttgactttgggaagtggcgtgctgttctgaggattgctgaccagtgtccctcc
agccttgctatccaggaaaatgccaacgctctggctcgctatgccagcatctgtcagcag
aatgggctggtgcctattgttgagccagaggtgctgcctgatggagaccatgacttagag
tactgccagtatgtttctgagaaggtcttggctgctgtctacaaggccctcaatgatcat
catgtttacctagaaggtaccctgctaaaaccaaacatggtaactgctgggcatgcctgc
agcaagaagtacacaccagagcaagtggctatggccaccgtcactgctctccatcgcact
gttcctgcagctgttcctggcatctgctttttgtctggaggcatgagtgaggaggatgct
acactcaacctcaatgctatcaaccgttgccctctgccaaagccctggaaactaagtttc
tcatatggaagagccctacaggctagtgctttggctgcctggggtggcaaggctgaaaac
aagaaggcaactcaagaagctttcatgaagcgggctctggccaattgccaggcagcacaa
ggaaagtatgtccacacaggttcttcaggtgctgctgctactcaatcgctcttcacagcc
tcctacacctactag

KEGG   Cricetulus griseus (Chinese hamster): 100760749Help
Entry
100760749         CDS       T02813                                 

Gene name
Aldoc
Definition
(RefSeq) fructose-bisphosphate aldolase C
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge04066  HIF-1 signaling pathway
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100760749 (Aldoc)
   00030 Pentose phosphate pathway
    100760749 (Aldoc)
   00051 Fructose and mannose metabolism
    100760749 (Aldoc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100760749 (Aldoc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100760749 (Aldoc)
   03036 Chromosome and associated proteins [BR:cge03036]
    100760749 (Aldoc)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100760749 (Aldoc)
Enzymes [BR:cge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     100760749 (Aldoc)
Membrane trafficking [BR:cge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100760749 (Aldoc)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100760749 (Aldoc)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100760749 (Aldoc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 100760749
NCBI-ProteinID: XP_027282394
LinkDB All DBs
Position
7
AA seq 363 aa AA seqDB search
MPHSYPALSAEQKRELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYR
QVLFSADDRVKKCIGGVIFFHETFYQKDDNGVPFVQTIQDKGILVGIKVDKGVVPLAGTD
GETTTQGLDGLLERCSQYKKDGADFAKWRCVLKISDRTPSALAIIENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHAC
PIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEASLNLNAINRCPLPRPWALTF
SYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQGRYEGSGDGGAAAQSLYVAN
HAY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccccactcgtacccagctctttctgctgagcagaagagggagctgtctgatattgcc
ctacggatcgtggccccaggcaaaggcattctggctgcagatgagtccgtaggcagcatg
gccaaaaggctgagccaaattggggtagagaacactgaggagaatcgccggctgtaccgc
caggttctattcagcgctgatgaccgtgtgaaaaagtgtattggtggcgttatcttcttc
catgagacattctaccagaaagatgataatggtgtcccctttgtccagaccatccaggat
aagggcattctcgtaggcatcaaggttgacaagggtgtagtgcctctagctggaactgat
ggggaaaccaccactcaagggctggatggactcttggaacgctgttctcagtataagaag
gatggtgctgattttgccaaatggcgctgtgtactgaagatcagcgatcgtacaccctca
gcgctggcaattatagagaatgccaatgtgctggcccgctatgccagcatctgccagcag
aatggtattgtgcctattgtggagcctgagatcctgcctgatggagaccatgacctcaaa
cgttgccagtatgttacagagaaggtcctggctgctgtgtacaaggccctgagtgatcat
catgtatacctggaagggactctgctcaagcccaacatggtgacccctggtcatgcctgt
cccatcaagtatagtccagaggagattgccatggctactgtcactgctcttcgtcgtact
gtgcccccagctgtcccaggagtgactttcctgtctgggggtcagagtgaagaggaggca
tccctcaacctcaatgccatcaatcgctgcccacttccccggccctgggccctcaccttc
tcctatggacgtgccctgcaggcatctgcactcaatgcctggagaggacaaagggacaat
gctggggctgctactgaggagtttatcaaacgggcagagatgaatgggcttgcagcccag
ggcagatatgaaggcagtggagatggaggagcagcagcacagtcgctctatgtcgccaac
catgcctactga

KEGG   Cricetulus griseus (Chinese hamster): 100771717Help
Entry
100771717         CDS       T02813                                 

Gene name
Aldoa
Definition
(RefSeq) fructose-bisphosphate aldolase A isoform X1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge04066  HIF-1 signaling pathway
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cge_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100771717 (Aldoa)
   00030 Pentose phosphate pathway
    100771717 (Aldoa)
   00051 Fructose and mannose metabolism
    100771717 (Aldoa)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100771717 (Aldoa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100771717 (Aldoa)
   03036 Chromosome and associated proteins [BR:cge03036]
    100771717 (Aldoa)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100771717 (Aldoa)
Enzymes [BR:cge01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     100771717 (Aldoa)
Membrane trafficking [BR:cge04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100771717 (Aldoa)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100771717 (Aldoa)
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100771717 (Aldoa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 100771717
NCBI-ProteinID: XP_027260427
LinkDB All DBs
Position
3
AA seq 418 aa AA seqDB search
MATRRQDGSTFNMTRLSLALAFSFPPVANEQLHPQLGNTQQQTELGKERAVTGAMPYPYP
ALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTA
DDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQ
GLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPI
VEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACTQKFSN
EEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRAL
QASALKAWGGKKENLKAAQEEYIKRALANSLACQGKYTPSGQSGAAASESLFISNHAY
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcgcaggcaagatgggtccaccttcaacatgacccgcctgtccctggctctg
gccttttcctttcccccagttgccaatgagcaactccaccctcagctgggcaacacccag
caacagacagagttaggaaaggaacgtgctgtcaccggcgccatgccctacccataccca
gcactgaccccggagcagaagaaggagctgtctgacatcgctcatcgaattgtggccccg
ggaaagggcatcctggctgcagatgagtccactggaagcattgccaagcgcctgcaatcc
attggcactgagaacaccgaagagaacaggcgtttctaccgccagctgctgctgactgct
gatgaccgtgtgaatccctgcattgggggggtgatccttttccatgaaacactgtaccag
aaggccgatgatggacgtcccttcccccaagttatcaagtccaagggcggtgttgtgggc
attaaggtagataaaggcgtggtgcctctggcaggaaccaatggtgagaccaccactcaa
ggactggatgggctgtctgaacgatgtgcccagtacaagaaggatggagctgactttgcc
aagtggcgttgtgtgctaaagattggggaacatactccctcagcccttgccatcatggaa
aatgccaatgttctggcccgttatgccagcatctgccagcagaatggcattgtacccatt
gtggagcccgaaatcctccctgatggggaccatgacttaaagcgctgtcagtatgtaact
gagaaggtactggctgctgtctacaaggctctgagtgaccaccatgtctatctggaaggc
acactgttgaagcccaacatggtcaccccaggccatgcctgtacccagaaattttccaat
gaggagattgccatggcaactgtcacagcacttcgtcgcacagtgccccctgctgttact
ggggtcactttcctgtctggagggcagagtgaggaagaggcatccatcaacctcaatgct
atcaacaagtgcccactgctgaagccatgggccttgactttctcttatggccgagccctg
caggcctctgctctgaaggcctggggtgggaagaaggagaatctgaaggctgcccaggag
gagtacatcaagcgagccctggccaacagcctcgcttgtcaaggaaagtataccccaagt
ggtcagtctggagctgcagccagtgaatctctcttcatctctaatcatgcctactaa

DBGET integrated database retrieval system