KEGG   Cricetulus griseus (Chinese hamster): 100755421
Entry
100755421         CDS       T02813                                 

Gene name
Mtor
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04066  HIF-1 signaling pathway
cge04072  Phospholipase D signaling pathway
cge04136  Autophagy - other
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04371  Apelin signaling pathway
cge04613  Neutrophil extracellular trap formation
cge04630  JAK-STAT signaling pathway
cge04659  Th17 cell differentiation
cge04714  Thermogenesis
cge04910  Insulin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04920  Adipocytokine signaling pathway
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05016  Huntington disease
cge05017  Spinocerebellar ataxia
cge05022  Pathways of neurodegeneration - multiple diseases
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05221  Acute myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100755421 (Mtor)
   04371 Apelin signaling pathway
    100755421 (Mtor)
   04630 JAK-STAT signaling pathway
    100755421 (Mtor)
   04066 HIF-1 signaling pathway
    100755421 (Mtor)
   04072 Phospholipase D signaling pathway
    100755421 (Mtor)
   04151 PI3K-Akt signaling pathway
    100755421 (Mtor)
   04152 AMPK signaling pathway
    100755421 (Mtor)
   04150 mTOR signaling pathway
    100755421 (Mtor)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100755421 (Mtor)
   04136 Autophagy - other
    100755421 (Mtor)
  09143 Cell growth and death
   04218 Cellular senescence
    100755421 (Mtor)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    100755421 (Mtor)
   04659 Th17 cell differentiation
    100755421 (Mtor)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100755421 (Mtor)
   04920 Adipocytokine signaling pathway
    100755421 (Mtor)
   04935 Growth hormone synthesis, secretion and action
    100755421 (Mtor)
   04919 Thyroid hormone signaling pathway
    100755421 (Mtor)
  09149 Aging
   04211 Longevity regulating pathway
    100755421 (Mtor)
   04213 Longevity regulating pathway - multiple species
    100755421 (Mtor)
  09159 Environmental adaptation
   04714 Thermogenesis
    100755421 (Mtor)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755421 (Mtor)
   05206 MicroRNAs in cancer
    100755421 (Mtor)
   05205 Proteoglycans in cancer
    100755421 (Mtor)
   05230 Central carbon metabolism in cancer
    100755421 (Mtor)
   05231 Choline metabolism in cancer
    100755421 (Mtor)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100755421 (Mtor)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100755421 (Mtor)
   05212 Pancreatic cancer
    100755421 (Mtor)
   05225 Hepatocellular carcinoma
    100755421 (Mtor)
   05226 Gastric cancer
    100755421 (Mtor)
   05214 Glioma
    100755421 (Mtor)
   05221 Acute myeloid leukemia
    100755421 (Mtor)
   05215 Prostate cancer
    100755421 (Mtor)
   05224 Breast cancer
    100755421 (Mtor)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100755421 (Mtor)
   05014 Amyotrophic lateral sclerosis
    100755421 (Mtor)
   05016 Huntington disease
    100755421 (Mtor)
   05017 Spinocerebellar ataxia
    100755421 (Mtor)
   05022 Pathways of neurodegeneration - multiple diseases
    100755421 (Mtor)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100755421 (Mtor)
   04931 Insulin resistance
    100755421 (Mtor)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100755421 (Mtor)
   05168 Herpes simplex virus 1 infection
    100755421 (Mtor)
   05163 Human cytomegalovirus infection
    100755421 (Mtor)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100755421 (Mtor)
   05165 Human papillomavirus infection
    100755421 (Mtor)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100755421 (Mtor)
   01522 Endocrine resistance
    100755421 (Mtor)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100755421 (Mtor)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100755421 (Mtor)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100755421 (Mtor)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100755421 (Mtor)
Membrane trafficking [BR:cge04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100755421 (Mtor)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N HEAT_EZ EPSP_synthase Nipped-B_C
Other DBs
NCBI-GeneID: 100755421
NCBI-ProteinID: XP_027254008
LinkDB
Position
2
AA seq 2549 aa
MLGTGPAVATASSATSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNSTRIGRFANYLRNLLPSSDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRSSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKTVQVDA
TVFTCVSMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVASITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLSFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSQGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGFTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGATPAILESLISINNKLQQPEAASGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTAHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAASAAAATSTEGSNSESETESNENSP
TPSPVQKKVTEDLSKTLLLYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRTTC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgctcgggacaggtcctgccgtggccaccgccagttcggccacatctagcaatgtgagc
gttctgcagcagtttgccagtggactgaagagccgaaatgaggagaccagagccaaagcg
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
acccgcttctacgaccagctgaaccatcacatttttgaactggtttccagctcagatgcc
aacgagaggaaaggtggcatcttggccattgccagcctcataggagtggaaggtggaaat
tccaccagaattggcagatttgcaaactaccttcggaacctcctcccctcaagtgatcca
gttgtcatggaaatggcatccaaggccattggccgccttgctatggcgggggataccttc
actgccgagtatgtggagtttgaagtgaaacgagctttggaatggctgggtgctgaccgc
aacgagggtcggagacatgcagctgttcttgttctccgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggctgtgtgggac
cccaagcaggccatacgagagggagctgtggctgcccttcgtgcctgtctgattctcacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtacaggcacacatttgaagag
gcagagaaagggtttgatgagaccctggccaaagagaagggcatgaatcgagatgatcga
atccatggggccttactcatcctcaacgagctagtccggatcagcagcatggagggagag
cgtctgagagaagagatggaagaaatcacccagcagcagctggtacatgacaagtactgc
aaagacctgatgggcttcgggacaaagcctcggcacatcacccccttcaccagttttcag
gctgtgcagccccagcagtcaaatgccttggtgggactgttggggtacagctcccaccaa
ggcctcatgggcttcggggcttcccccagtcctgccaagtccaccctggtggaaagccgc
tgttgcagggacttgatggaagagaaatttgatcaggtgtgccagtgggtactgaaatgc
aggagcagcaagaactccctgatccaaatgacaatccttaatctgttgccccgcttggct
gcattccgaccttctgccttcacagacacccagtacctccaggataccatgaaccacgtc
ctgagctgtgtcaagaaggagaaggaacggactgcagcattccaggccctaggactgctt
tctgtggccgtgaggtccgagtttaaggtctacttgccccgtgtactagacatcatccga
gcagcgctgccccccaaggactttgcacacaagaggcagaaaaccgtgcaggtggatgcc
acagttttcacatgcgtcagcatgctggcacgagccatggggccgggcatccagcaggac
atcaaggagctgctagagcccatgttggcagtgggcctgagccctgcgcttaccgctgtg
ctctacgacctgagccggcagattccgcagctgaagaaagatatccaggatgggctcctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggctcaccagctggcctcgcctggcctcaccaccctccctgaggccagcgatgtggcc
agcatcactcttgcccttcgaacccttggaagctttgaatttgagggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaagctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccac
gcccatgtggttagccagacagccgtgcaagtggtggcagatgttctcagcaagctgctt
gtggttgggataacagaccctgaccctgatatccgctactgcgttttggcgtccctggat
gagcgcttcgatgcccacctggcccaagcggaaaacttacaggctctgtttgtggccctg
aacgaccaggtctttgagatccgagagctggccatctgcacagtgggtcgactcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggtattgggagaatcaaggagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctatatggagcctattctaaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggagtgatcaataacgtattggcc
acaataggagagctggctcaggttagtggcctagaaatgagaaagtgggttgatgagctc
tttatcatcatcatggacatgctgcaggactcctctctgctggccaagaggcaggtggcc
ctgtggaccctgggacagttggtagccagcactggctatgtggtggagccctataggaaa
taccccactctgctcgaggtgctgctgagcttcctgaagactgagcagaaccagggcaca
cggagagaggctatccgagtgttagggctccttggggctctggatccctacaagcacaaa
gtgaacatcggcatgattgaccaatcccgggacgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagcgaaatgctggtcaacatgggaaac
ctgcctctggatgagttctacccagctgtgtccatggtggccttgatgcgtatcttccgg
gaccagtccctctctcaccaccacaccatggtagttcaggccatcaccttcatcttcaag
tccctggggctcaaatgcgtgcagttcctgccccaagtcatgcctacgttccttaatgtc
atccgggtctgtgatggagccatccgggaatttctgttccagcagctgggaatgctggtg
tcctttgtgaagagccacatccgcccttacatggatgaaattgtcaccctcatgagagaa
ttctgggtcatgaacacctcaatccagagcacaatcattcttctcattgagcaaattgtg
gtggctcttggcggggaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagccaaggccgaatcgtctccatcaagctattggcagccatc
cagctgtttggtgccaacctggatgactacctgcatttgttgttgcctccaattgtgaag
ttgtttgatgcccctgaagtcccactgccatcgaggaaggcagcgttggagacagtggac
cgcctgacagagtccctagacttcactgactatgcctcccgcatcattcaccccatcgtt
cgcacgctggaccagagcccggagctgcgctccacagccatggacacactgtcttcactt
gtctttcagctggggaagaagtaccaaattttcattccaatggtgaataaagtcctggta
cgacaccggatcaatcaccagcgctatgacgtgctcatctgcagaatcgtcaaggggttc
acactcgctgatgaggaggaagaccctctgatttaccagcaccgaatgctcaggagtggc
caaggagatgcgctggccagtggaccagttgaaacaggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcgtggggagctgccagaagggtctcgaaagatgactgg
ctggagtggctgagacggctgagtctggagctgctgaaggactcctcatcgccttccctg
cgctcgtgctgggccctggctcaggcctacaacccaatggccagggatctcttcaatgct
gcttttgtgtcctgctggtctgaactgaatgaagaccaacaagacgagctcatcaggagc
attgagttggccctcacctctcaagacatcgctgaagtcacgcaaaccctcttgaacctg
gctgagttcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gtgctattgggggagagagctgccaagtgccgagcgtatgcaaaagcactacactacaaa
gaactggagttccagaaaggggccacacctgccatactcgagtccctcatcagcattaat
aataagctacaacagcctgaggcagcttccggtgtgttagaatatgccatgaaacacttt
ggagagctggagatccaggccacctggtatgagaaactgcatgagtgggaggatgctctt
gtggcctatgacaagaagatggacacgaacaaggatgacccagagctgatgctgggccgc
atgcgctgtcttgaagccttgggggaatgggggcagcttcatcagcagtgctgtgaaaag
tggactctggttaatgatgagacccaggctaagatggcccggatggcggctgcagcagca
tggggtttaggtcagtgggacagcatggaggagtacacttgtatgattcctcgggatacc
cacgatggagcattttacagagctgtgctggcgttacatcaggatctcttctccttggcc
caacaatgcattgacaaggccagggacctgctggatgctgagctgacggccatggcagga
gagagctacagccgagcctatggggccatggtttcttgccacatgctgtctgagctggag
gaggttatccagtacaaactggtacctgagcgacgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtccgg
tcccttgtggtcagccctcacgaggacatgagaacctggctcaagtacgcaagcctgtgt
ggcaagagtggcaggctggctcttgctcacaagaccttagtgctgctcttgggagttgat
ccgtctcggcagcttgaccatcctctgccgacagctcaccctcaggtgacctatgcctac
atgaaaaacatgtggaaaagtgctcgaaagatcgatgccttccagcacatgcagcacttc
gtccagaccatgcagcagcaggcccagcacgccatcgccaccgaggaccagcagcacaag
caggagctgcataagctcatggctaggtgtttcctgaaacttggggagtggcagctgaac
cttcagggcatcaatgagagcaccatccccaaggtgctgcagtactacagtgcggccacc
gagcatgaccgcagctggtacaaggcttggcatgcgtgggcagtgatgaactttgaagcc
gtgctgcactacaaacatcaaaatcaagcccgtgatgagaagaagaaactacgtcacgcc
agcggggccaacatcaccaatgccaccacagctgccaccacagctgcctccgcggccgct
gccaccagcacagagggcagcaacagcgagagcgagactgagagcaatgagaacagcccc
accccgtcccctgtgcagaagaaggtcactgaggatttgtccaaaaccctcttgttgtac
actgtccctgctgtccaaggcttcttccgttctatctccttgtcgagaggcaacaaccta
caggatacactcagagtcctcaccttgtggtttgattatggtcattggccagatgtcaat
gaagccttggtggaaggggtgaaggccatacagattgacacttggttacaggttatacct
cagctaattgcaagaattgacacgcccagacccttggtgggccggctcattcaccagctt
ctcacagacattggtcgctaccatccccaggccctcatctatcccctgacggtggcttct
aagtccaccacgacagcccgtcacaacgcagccaacaagatcctgaagaacatgtgtgag
cacagtaacacgctggtccagcaggccatgatggtgagcgaagagctgattcgagtagcc
atcctctggcatgagatgtggcatgaaggcctggaagaggcgtcgcgcttgtactttggg
gagaggaacgtgaaaggcatgtttgaggtgctggagcccctgcatgctatgatggagcgg
ggcccccagacgctaaaggagacgtcctttaatcaggcatatgggcgagatttgatggag
gcacaagagtggtgcagaaagtacatgaaatcaggaaatgtcaaggacctcacccaagcc
tgggacctctattatcacgtgttcagaaggatctccaagcagttaccccagctcacatcc
ctggagctgcagtatgtttcccccaaacttctcatgtgccgggaccttgaattggctgtg
ccaggaacgtatgaccccaaccagccaatcattcgcattcagtccatagccccgtctttg
caagtcatcacgtccaagcagaggccccggaagctgacgctgatgggcagcaatgggcac
gagtttgttttcctgctgaaaggccatgaagatctgcggcaggatgagcgtgtgatgcag
ctcttcggcctggtgaacacgctcctggccaatgaccctacttctcttcggaaaaacctc
agcatccagagatacgcagtcatcccgctgtccaccaactcgggcctcattggctgggtc
ccccactgtgacacgctgcacgccctcatccgggactaccgggagaagaagaagattctc
ctgaacatcgagcatcgcatcatgcttcgaatggctcctgactatgaccacctgactctg
atgcagaaggtggaggtgttcgagcatgcggtcaacaacacagctggggacgacctggcc
aagctactgtggctgaaaagccccagctcagaggtgtggtttgaccgaagaaccaactat
acccgctccttagccgtcatgtcaatggttggatacattttaggcctgggagacagacac
ccatccaacctgatgctggaccggctgagcgggaagatcctgcacatcgacttcggggac
tgctttgaggttgctatgaccagagagaaatttccagaaaagattccatttagactaaca
agaatgttgaccaacgctatggaggttacaggtctggatggcaactatagaaccacctgc
cacacagtgatggaagtgcttcgggaacataaggacagcgtcatggctgtactggaagcc
tttgtctatgaccctttgctgaactggaggctaatggacacaaataccaaaggcaacaag
cggtcccgaacgaggacagactcctactctgcaggccagtcagtagaaattttggacggt
gtagaacttggcgaaccagcccataagaaaacagggaccacggtgccagaatccattcat
tctttcattggagatggtttggtgaaaccagaagccttaaacaagaaagctattcagatt
attaacagggttcgagataagcttactggtcgggatttctctcatgacgacaccttggac
gttccaacccaggtggagctgcttatcaagcaagcaacgtcccatgagaacctctgccag
tgctacattggctggtgtcccttctggtga

DBGET integrated database retrieval system