KEGG   Cricetulus griseus (Chinese hamster): 100755642
Entry
100755642         CDS       T02813                                 

Gene name
Il4
Definition
(RefSeq) interleukin-4
  KO
K05430  interleukin 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
cge04151  PI3K-Akt signaling pathway
cge04630  JAK-STAT signaling pathway
cge04640  Hematopoietic cell lineage
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04672  Intestinal immune network for IgA production
cge05140  Leishmaniasis
cge05200  Pathways in cancer
cge05310  Asthma
cge05320  Autoimmune thyroid disease
cge05321  Inflammatory bowel disease
cge05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100755642 (Il4)
   04151 PI3K-Akt signaling pathway
    100755642 (Il4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100755642 (Il4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100755642 (Il4)
   04660 T cell receptor signaling pathway
    100755642 (Il4)
   04658 Th1 and Th2 cell differentiation
    100755642 (Il4)
   04659 Th17 cell differentiation
    100755642 (Il4)
   04657 IL-17 signaling pathway
    100755642 (Il4)
   04664 Fc epsilon RI signaling pathway
    100755642 (Il4)
   04672 Intestinal immune network for IgA production
    100755642 (Il4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755642 (Il4)
  09163 Immune disease
   05310 Asthma
    100755642 (Il4)
   05320 Autoimmune thyroid disease
    100755642 (Il4)
   05321 Inflammatory bowel disease
    100755642 (Il4)
   05330 Allograft rejection
    100755642 (Il4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100755642 (Il4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100755642 (Il4)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100755642 (Il4)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Interleukins
   100755642 (Il4)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Haparin
  Cytokines
   100755642 (Il4)
SSDB
Motif
Pfam: IL4 DUF3385
Other DBs
NCBI-GeneID: 100755642
NCBI-ProteinID: XP_027282017
LinkDB
Position
7
AA seq 147 aa
MGLRPQLAAILLCLLACTGNWTHGCHNGALKEIIHILNQVTLKGTPCTEMVVPDVLSARK
NSTEKDLICKASQVLRKFYFPGEVTLCLKNNSRVLKDLRKLFRGISGLFPEKSCSVNEST
YTTLRDFLESLIRIMRKKYWQCGSSAF
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtctcaggccccagctagctgccatcctgctctgccttctagcatgtaccgggaac
tggacccacggatgccacaacggagccttgaaagagatcatccacattttgaaccaggtc
acattaaaagggacaccatgcaccgagatggtcgtaccagatgtcctttcagcaaggaag
aactctacagagaaagacctcatctgcaaggcttcccaggtgcttcgcaaattttatttc
ccaggtgaggtgactctgtgcttgaagaacaattccagggttctcaaagacctgagaaaa
ctcttcaggggcatcagtggcctgtttccagagaagagctgcagtgtgaatgagtccacg
tacacaacactgagagacttcttggaaagcctaataaggatcatgcgaaagaaatactgg
cagtgtggaagttctgcgttttaa

DBGET integrated database retrieval system