KEGG   Cricetulus griseus (Chinese hamster): 100755773
Entry
100755773         CDS       T02813                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04060  Cytokine-cytokine receptor interaction
cge04061  Viral protein interaction with cytokine and cytokine receptor
cge04151  PI3K-Akt signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04630  Jak-STAT signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04672  Intestinal immune network for IgA production
cge04940  Type I diabetes mellitus
cge05135  Yersinia infection
cge05142  Chagas disease (American trypanosomiasis)
cge05162  Measles
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05320  Autoimmune thyroid disease
cge05321  Inflammatory bowel disease (IBD)
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100755773 (Il2)
   04151 PI3K-Akt signaling pathway
    100755773 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100755773 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100755773 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100755773 (Il2)
   04660 T cell receptor signaling pathway
    100755773 (Il2)
   04658 Th1 and Th2 cell differentiation
    100755773 (Il2)
   04659 Th17 cell differentiation
    100755773 (Il2)
   04672 Intestinal immune network for IgA production
    100755773 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755773 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100755773 (Il2)
   05321 Inflammatory bowel disease (IBD)
    100755773 (Il2)
   05330 Allograft rejection
    100755773 (Il2)
   05332 Graft-versus-host disease
    100755773 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100755773 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100755773 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100755773 (Il2)
   05162 Measles
    100755773 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100755773 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100755773 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100755773 (Il2)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Interleukins
   100755773 (Il2)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Haparin
  Cytokines
   100755773 (Il2)
SSDB
Motif
Pfam: IL2 Desmo_N
Other DBs
NCBI-GeneID: 100755773
NCBI-ProteinID: XP_027247617
LinkDB
Position
1
AA seq 155 aa
MYTMQLASCLALTLALLVNSAPTSSSKKETQQHLEQLLLDLQVLLKGINNNKNPKLPMML
TFKFYMPKKATELKHLQCLEEELGALQSVLDLAQSKSFQLEDTENFISNIRVTVVKLKGS
ENTFTCEFDDETVTVVEFLSRWITFCQSIIATMTQ
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacaccatgcagcttgcatcctgtcttgcactgacgctcgcactcctcgtcaacagt
gcgcccacttcaagctctaaaaaggaaacccagcagcacctcgagcagttactgctggac
ttacaggtgcttctgaaagggatcaataataacaagaatccgaaactccccatgatgctc
acgtttaaattttacatgcccaagaaggccacagaactgaaacatctccagtgcctggaa
gaagaacttggagccctgcagagtgtgctggatttggctcaaagcaaaagctttcagttg
gaagatactgagaatttcatcagcaatatcagagtaacagttgtgaaactaaagggctct
gaaaacacattcacgtgtgaattcgatgatgagacagtaactgtggtggaatttctgagc
agatggatcaccttctgtcaaagcatcattgcaacaatgactcaataa

DBGET integrated database retrieval system