KEGG   Cricetulus griseus (Chinese hamster): 100756318Help
Entry
100756318         CDS       T02813                                 

Gene name
Tgm5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
cge  Cricetulus griseus (Chinese hamster)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100756318 (Tgm5)
Enzymes [BR:cge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100756318 (Tgm5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100756318
NCBI-ProteinID: XP_007620593
LinkDB All DBs
Position
Un
AA seq 719 aa AA seqDB search
FVPGCPITGLEVALTDFQSSRNNVRHRTEEISVDRLVVRRGQAFSITLYFKNRGFQPGMD
SIIFVAETGPLPDLAKGTRAVFSLTGSGGSSPWIASLEANRDTSLEVSLCAPPMAAVGRY
LLKIRIDSYQGSVTAYQLGEFILLFNPWCPGDAVYLDSEPQRQEYVMNDYGFIYQGSKSW
ILPCPWNYGQFEENIIDICLELLEKSLNFQIDPSTDCALRGSPVYTSRVVCAMINSNDDN
GVLNGNWSENYFDGANPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAVMCTVMRCLGIP
TRVITNFDSGHDTDGNLIIDEYYDNTGRILENMKKDTVWNYHVWNECWMARKDLPPGYGG
WQVLDATPQETSNGLYCCGPASVKAIKEGEVDLNYDTCFAFSMVNADCVSWLVYGGKEQK
LHRDTATVGNFISTKSIQSDERDDITESYKYEEGSLQERQVFLKALQKLKSVRSQGSHQG
DLNPFSSMPPRSLDTPSLRPSDVVQVSLKFELLDPPNMGQDINFVLLAVNLSPQFKDLKL
NLSAQSLLHDGSPLAPFWQDVAFITLFPQEEKTYPCKILYSQYSQYLSTDKLIRISALGE
EKNSSEKILVNKIITLTFPGIVINVLGAAFVNQPLTVQVVFSNPLSEPVEDCVLTLEGSG
LFKKQQRVLIGVLKPHHKASITLKTVPFKSGQRQIQANLRSNKFKDIKGYRNVYVDIGL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
tttgtcccaggctgccccatcacagggctagaggtggccctcacagacttccagagctcc
cggaacaatgtgcgtcaccgcacagaagagatcagtgttgaccgccttgttgtccgccgt
ggccaggccttcagtatcaccctctactttaagaaccggggcttccagccaggcatggac
agtatcatctttgtggctgagactggacccttgccagacctggccaaagggacacgggca
gtgtttagcctcacaggcagtggtggctcaagcccctggattgcttccctggaggccaat
agagacacctccctggaagtgagcctgtgtgcccctcccatggcagccgtgggtcgatac
ctgctgaaaattcgcatcgactcctaccagggttctgtcacggcctaccagctcggggag
ttcatcctgctcttcaatccctggtgtccaggggatgcagtctacttggacagtgagccc
cagaggcaggagtatgttatgaatgattatggcttcatctaccaaggaagtaagagctgg
atcctcccatgtccctggaactatgggcagtttgaggagaatatcatagacatctgcttg
gagctgctagagaagagtctgaacttccagattgacccatccacagactgtgccctgcgg
ggaagccccgtctacaccagcagagttgtgtgtgccatgataaacagcaatgatgacaac
ggggtgctcaatggcaactggagtgaaaattatttcgacggtgccaaccctgcagagtgg
actggcagtgtggccatcctaaaacagtggcatgccaccggctgccaaccagtgcgatat
gggcaatgctgggtctttgctgctgtcatgtgcacagtgatgaggtgcctggggatcccc
acccgtgtgatcaccaactttgactccggccatgacacagatgggaacctgatcatagat
gagtattacgacaacacaggcaggattttggagaatatgaagaaggacactgtctggaat
tatcatgtgtggaatgagtgctggatggcacgcaaggacctccctcctggatatggaggt
tggcaggtgctggatgctacaccccaggaaaccagcaatggtctctactgctgtggccct
gcttctgtcaaagccatcaaagagggagaagtggatctaaactatgacacatgctttgcg
ttttccatggtgaatgctgactgcgtgtcctggcttgtctatggagggaaggagcagaaa
cttcaccgggacacagctactgttgggaattttatcagtactaagagcatccagagtgat
gagcgggatgatatcacagagagctacaagtatgaagaaggctcccttcaagagagacag
gtgtttctaaaggctctacagaagctaaagtctgtaaggtctcaagggtcccaccaagga
gacttgaatcccttcagctccatgccaccaaggagcctggatacaccttcccttcgaccc
agtgatgttgtccaggtctctctgaagtttgagctgcttgacccacccaatatgggccaa
gacataaactttgtcctgttggctgtcaacttgtcacctcagttcaaggatctcaaactc
aatttgagtgcccagtctctgttgcatgatggcagccccctggccccattctggcaggat
gtagcattcatcacactgttccctcaagaagaaaagacctacccttgcaaaatcctctac
tcccagtacagccagtatctgtcaacagacaagctaatccgcatcagtgccctgggtgaa
gagaagaacagttctgagaaaatcctggtgaacaagatcatcaccctgactttcccaggc
atcgtgattaatgttctaggagcagcctttgtgaatcagccactcactgtccaggtggtc
ttttcaaacccactctcagagccagttgaggactgtgtgctgaccttggaaggaagtggc
ctctttaagaagcagcagagagttctcattggagtcctcaaaccccatcacaaagccagc
atcactctgaagactgtccctttcaagagtggccaaaggcagatccaagctaatctgagg
agcaataagtttaaagacatcaagggttacaggaatgtgtacgttgacattggcttataa

DBGET integrated database retrieval system