KEGG   Cricetulus griseus (Chinese hamster): 100756509Help
Entry
100756509         CDS       T02813                                 

Gene name
Aldh7a1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00053  Ascorbate and aldarate metabolism
cge00071  Fatty acid degradation
cge00260  Glycine, serine and threonine metabolism
cge00280  Valine, leucine and isoleucine degradation
cge00310  Lysine degradation
cge00330  Arginine and proline metabolism
cge00340  Histidine metabolism
cge00380  Tryptophan metabolism
cge00410  beta-Alanine metabolism
cge00561  Glycerolipid metabolism
cge00620  Pyruvate metabolism
cge01100  Metabolic pathways
Module
cge_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cge_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100756509 (Aldh7a1)
   00053 Ascorbate and aldarate metabolism
    100756509 (Aldh7a1)
   00620 Pyruvate metabolism
    100756509 (Aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100756509 (Aldh7a1)
   00561 Glycerolipid metabolism
    100756509 (Aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100756509 (Aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    100756509 (Aldh7a1)
   00310 Lysine degradation
    100756509 (Aldh7a1)
   00330 Arginine and proline metabolism
    100756509 (Aldh7a1)
   00340 Histidine metabolism
    100756509 (Aldh7a1)
   00380 Tryptophan metabolism
    100756509 (Aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100756509 (Aldh7a1)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100756509 (Aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     100756509 (Aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     100756509 (Aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA DUF1487 MTA_R1
Motif
Other DBs
NCBI-GeneID: 100756509
NCBI-ProteinID: XP_007622016
LinkDB All DBs
Position
Un
AA seq 539 aa AA seqDB search
MWRVARTVCEHTVKSIRHSRSPCRPTAHMSTLLIHHPDYAWLQELGLREDNAGVYNGNWR
GGGQVITSYCPANNEPIARIRQASMEDYEETIKEAKEAWKMWAEIPAPKRGEIVRKIGLA
LREKIRVLGKLVSLEMGKILVEGIGEVQEFVDICDYAAGLSRMIGGPVLPSERPGHALIE
QWNPLGLVGIITAFNFPVAVFGWNNAIALITGNVCIWKGAPTTSLVTIAVTKIIAKVLED
NDLPGAICSMTCGGADIGTAMAKDTRVNLLSFTGSTQVGKQVALMVQERFGKSLLELGGN
NAIIAFEDADLSLVLPSALFAAVGTAGQRCTSVRRLFLHESIHEEVVQRLKGAYSQIRVG
NPWDRNILYGPLHTKQAVSMFVRAVEEIKKQGGTVVYGGKVMDHPGNYVEPTIVTGLAHD
APIVHEETFAPILYIFKFKNEQEVFAWNNEVKQGLSSSIFTKDLGRIFRWIGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSTDLPLAQGIKFE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtgtggctcgcactgtgtgcgagcatactgtgaagagcatcaggcattcccgt
tctccgtgcaggcctaccgcccacatgtccactctgctgatccatcatcccgactatgct
tggctgcaagagctggggctccgcgaggacaacgcgggcgtgtataatggaaactggcgc
ggcgggggacaggtaattacgtcctattgtcctgctaacaatgagccaatagcaaggatc
cgacaggccagtatggaagactatgaagaaactataaaggaagccaaggaagcttggaaa
atgtgggcagagattcctgccccaaagcgaggagaaatagtaagaaagattggcctggcc
ttgcgggagaagatccgagtactgggaaaactggtgtctttggaaatggggaagatctta
gtggaaggaataggagaagttcaggagttcgtggacatttgtgattacgctgctggcttg
tcgaggatgatcgggggacccgtcttgccttctgaaagacctggccatgctctcatcgag
cagtggaacccgttaggcctggtgggaatcatcactgccttcaatttcccagtggccgtg
tttggctggaacaacgccatagcgctgatcacagggaatgtctgcatctggaaaggagcc
ccaacaacttctctcgttactatagctgtcacaaagatcatagccaaggttttggaggac
aatgatctgcctggtgccatttgttccatgacttgtggtggagcagatattggcacagca
atggccaaagatacacgtgtgaacctgctgtccttcactggaagcactcaggtggggaaa
caggtggccctgatggtgcaagagaggtttgggaaaagcttgttggagcttggtggaaac
aatgccattatagctttcgaggatgcagacctcagcctggttctgccatcagctctgttt
gctgccgtgggaacagctggacaaaggtgtacctctgtgaggcgactgtttttgcacgaa
agtatccatgaggaggttgtacaaagactgaaaggtgcctactcgcagatccgtgttggc
aacccctgggaccggaatattctctatggaccactgcataccaaacaggcagtgagcatg
tttgttagagccgtggaagaaataaagaaacaaggaggcacagtggtctatgggggcaag
gttatggatcatcctggcaattatgtagagcccaccattgtgactggtcttgcccatgat
gcacccattgtgcatgaggagacttttgccccaattctctacatcttcaaattcaagaat
gaacaagaggtttttgcatggaataatgaagtgaaacaaggactttcaagtagtattttt
accaaggatttgggcagaatcttcagatggattggacccaaaggttcagactgtggcatt
gtgaacgtcaatattcctaccagcggggctgagattggcggtgcatttggaggagagaag
cacactggcggtggcagggaatctggcagcgatgcctggaagcagtacatgcgaagatcc
acatgtaccatcaactacagcacggaccttcctctggctcaaggcatcaagtttgagtga

DBGET integrated database retrieval system