KEGG   Cricetulus griseus (Chinese hamster): 100756705
Entry
100756705         CDS       T02813                                 

Gene name
Ddb2
Definition
(RefSeq) LOW QUALITY PROTEIN: DNA damage-binding protein 2
  KO
K10140  DNA damage-binding protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03420  Nucleotide excision repair
cge04115  p53 signaling pathway
cge04120  Ubiquitin mediated proteolysis
cge05161  Hepatitis B
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100756705 (Ddb2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100756705 (Ddb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100756705 (Ddb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100756705 (Ddb2)
   05202 Transcriptional misregulation in cancer
    100756705 (Ddb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100756705 (Ddb2)
   05212 Pancreatic cancer
    100756705 (Ddb2)
   05225 Hepatocellular carcinoma
    100756705 (Ddb2)
   05226 Gastric cancer
    100756705 (Ddb2)
   05214 Glioma
    100756705 (Ddb2)
   05216 Thyroid cancer
    100756705 (Ddb2)
   05220 Chronic myeloid leukemia
    100756705 (Ddb2)
   05217 Basal cell carcinoma
    100756705 (Ddb2)
   05218 Melanoma
    100756705 (Ddb2)
   05213 Endometrial cancer
    100756705 (Ddb2)
   05224 Breast cancer
    100756705 (Ddb2)
   05222 Small cell lung cancer
    100756705 (Ddb2)
   05223 Non-small cell lung cancer
    100756705 (Ddb2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100756705 (Ddb2)
   05169 Epstein-Barr virus infection
    100756705 (Ddb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cge04121]
    100756705 (Ddb2)
   03400 DNA repair and recombination proteins [BR:cge03400]
    100756705 (Ddb2)
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100756705 (Ddb2)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100756705 (Ddb2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 100756705
NCBI-ProteinID: XP_027278379
LinkDB
Position
6
AA seq 491 aa
MAPKKCPETQKSPDVALLLKSKSRRSPQELEPEAKKLRAQGPVSSRKCQSCCLLAELSSL
QIPPRSSSIIRDLYQHKLGKANWPSLQQGLQKSFLHSLASYRVFQKAAPFDRRTTSLAWH
PTHPSTVAVGSKGGDIMIWNFGIKDKPIFIKGIGAGGSITGLKFSHLNSNQFFASSMEGT
TRLQDFKGNTLRVYTSSNSCKVWFCSLDVSAKSQVVVTGDNVGHVILLHTDGKQLWNLRL
HKKKVAHVALNPCCDWLLATASVDQTVKIWDLRQIKSKTSFLYSLPHRHAVNAACFSPDG
ARLLTTDQNNEIRVYSASQWDSPLSLISHPHRHFQHLTPIKATWHPRHNLIVVGRYPDPN
LKSCVPYELRTIDVFDGSSGKMMCQLYDPGYSGITSLNEFNPMGDTLASAMGYHILIWRQ
EEARSXKDYEYLDPTNGKKFCEKRQLFVKGPEVLSSQGWRRDTCGMDTVQLRYWHVTALD
FAPETKRKPLH
NT seq 1476 nt   +upstreamnt  +downstreamnt
atggctcccaagaaatgcccagaaacccagaagtcccccgacgttgcgctgctcctcaag
agcaaaagccgcagaagtcctcaggagctggagcccgaagccaagaagctgcgtgcacag
ggtcccgtttctagcaggaaatgtcagtcgtgctgccttttggcagagttgtctagcctg
cagatccctccacggagtagcagcatcatcagagatctttaccagcataagttgggcaaa
gccaactggccatcactacagcagggtctccagaagtcctttttgcactctctggcttct
taccgggtattccaaaaagctgccccctttgacaggaggactacatccttggcatggcac
ccaactcatcccagtaccgtggctgtgggctccaaagggggagatatcatgatctggaac
tttggcataaaggacaaacctatcttcattaaagggattggagctggaggaagcatcact
gggctgaagtttagccatctcaattccaatcagttttttgcttcctcaatggagggaaca
accaggctgcaggactttaaaggcaacactctccgagtttataccagctcaaactcttgc
aaggtctggttttgcagccttgatgtttctgccaagagccaagtggtggtcacaggagac
aatgtgggacacgtgatcctactgcacacagatggcaagcagctttggaatctcagacta
cacaaaaagaaagtagcccacgtggccctgaatccctgctgtgattggcttctggccaca
gcctccgtagatcaaacagtgaaaatctgggacctgcgccaaattaaaagcaaaaccagc
ttcctctactcactgcctcacaggcatgctgtcaatgcagcctgttttagcccggatgga
gcccggctcctgactaccgaccagaacaatgagattcgggtttactctgcctcccagtgg
gacagccccctgagcctgatctcccaccctcaccgtcactttcagcacctcacacccatc
aaggcaacctggcatccacggcacaacctcattgttgtgggccgatacccagatcctaat
ctcaaaagttgtgttccctatgaactaaggacaatagatgtgtttgatggaagctcgggg
aagatgatgtgccagctttatgatccaggatattctggtatcacttcgctcaatgagttc
aacccaatgggggacacactggcctccgctatgggttaccatattctcatttggaggcaa
gaggaagccaggtcatagaaagattatgaatacctggaccccacaaatgggaagaagttc
tgtgagaagaggcagctatttgttaagggaccagaagttctcagctctcaaggttggagg
agggacacttgtggcatggatactgtgcaactaagatactggcatgttactgctctagat
tttgctccagaaacgaagagaaaaccactgcactaa

DBGET integrated database retrieval system