KEGG   Cricetulus griseus (Chinese hamster): 100756831
Entry
100756831         CDS       T02813                                 

Gene name
Tgfb3
Definition
(RefSeq) transforming growth factor beta-3 proprotein isoform X1
  KO
K13377  transforming growth factor beta-3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04060  Cytokine-cytokine receptor interaction
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04218  Cellular senescence
cge04350  TGF-beta signaling pathway
cge04390  Hippo signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05144  Malaria
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05321  Inflammatory bowel disease
cge05323  Rheumatoid arthritis
cge05410  Hypertrophic cardiomyopathy
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100756831 (Tgfb3)
   04350 TGF-beta signaling pathway
    100756831 (Tgfb3)
   04390 Hippo signaling pathway
    100756831 (Tgfb3)
   04068 FoxO signaling pathway
    100756831 (Tgfb3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100756831 (Tgfb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100756831 (Tgfb3)
   04218 Cellular senescence
    100756831 (Tgfb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100756831 (Tgfb3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100756831 (Tgfb3)
   05212 Pancreatic cancer
    100756831 (Tgfb3)
   05225 Hepatocellular carcinoma
    100756831 (Tgfb3)
   05226 Gastric cancer
    100756831 (Tgfb3)
   05220 Chronic myeloid leukemia
    100756831 (Tgfb3)
   05211 Renal cell carcinoma
    100756831 (Tgfb3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100756831 (Tgfb3)
   05321 Inflammatory bowel disease
    100756831 (Tgfb3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100756831 (Tgfb3)
   05414 Dilated cardiomyopathy
    100756831 (Tgfb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100756831 (Tgfb3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100756831 (Tgfb3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100756831 (Tgfb3)
   05161 Hepatitis B
    100756831 (Tgfb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100756831 (Tgfb3)
   05144 Malaria
    100756831 (Tgfb3)
   05145 Toxoplasmosis
    100756831 (Tgfb3)
   05140 Leishmaniasis
    100756831 (Tgfb3)
   05142 Chagas disease
    100756831 (Tgfb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100756831 (Tgfb3)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100756831 (Tgfb3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100756831
NCBI-ProteinID: XP_027274373
UniProt: G3HFS5
LinkDB
Position
5
AA seq 410 aa
MLLQRALVVLALLNLATVSFSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVM
THVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEYYAKEIHKFDMIQGLAEHNELAV
CPKGITSKVFRFNVSSVEKNGTNLFRAEFRVLRVPNPSSKRTEQRIELFQILRPDEHIAK
QRYIGGKNLPTRGTAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENV
HEVMEIKFKGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDSPGQGGQRKKRAL
DTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVL
GLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgctcttgcaaagggctctggtggtcctggccctactgaacttggccacagtaagcttc
tctctgtccacttgcaccaccttggacttcggccacatcaagaagaaaagggtggaagcc
attaggggacagatcttgagcaagctcaggctcaccagtccccctgagccatcggtgatg
acccacgtcccctatcaggtcctggcactttacaacagcacccgggagttgctggaagag
atgcacggggagagggaggaaggctgcactcaggagaacactgagtcggagtactatgcc
aaagagatccataaattcgacatgatccaggggctggcggagcacaatgaactggctgtc
tgccccaaagggattacctctaaggtttttcgcttcaacgtgtcctcagtggagaaaaat
ggaactaatctgttccgggcagagttccgggtcttgcgggtgcccaaccccagctccaag
cgcactgagcagagaattgagctcttccagatacttcgaccagatgagcacattgccaag
cagcgctatattggtggcaagaatctgcccacaaggggcactgctgagtggctgtcgttt
gatgtcactgacactgtccgtgagtggctgttgcggagagagtccaacttgggtctggaa
atcagcattcactgtccatgtcacacctttcagcccaatggagacatactggaaaatgtt
cacgaggtgatggaaatcaaattcaaaggagtggacaatgaagatgaccatggccgggga
gacctggggcgcctcaagaagcagaaggatcaccacaaccctcacctgatcctcatgatg
atccctccacaccgactggacagtccaggccagggcggccagaggaagaagcgggccctg
gataccaattactgcttccgcaacttggaggagaactgctgtgtccgccccctctacatt
gacttccggcaggatctgggctggaaatgggtccacgaacctaagggttactatgccaac
ttctgctcaggcccttgcccgtacctccgcagtgcagacacaacccatagcacggtgctg
ggactgtacaataccctgaacccggaggcatcggcttctccgtgctgtgtgccgcaggac
ctggagcccctgaccatcctgtactatgttggcaggacccccaaggtggagcagctgtcc
aacatggtggtgaagtcgtgcaagtgcagctga

KEGG   Cricetulus griseus (Chinese hamster): 100773359
Entry
100773359         CDS       T02813                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta-1 proprotein isoform X2
  KO
K13375  transforming growth factor beta-1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04060  Cytokine-cytokine receptor interaction
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04218  Cellular senescence
cge04350  TGF-beta signaling pathway
cge04380  Osteoclast differentiation
cge04390  Hippo signaling pathway
cge04659  Th17 cell differentiation
cge04672  Intestinal immune network for IgA production
cge04926  Relaxin signaling pathway
cge04932  Non-alcoholic fatty liver disease
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05144  Malaria
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05321  Inflammatory bowel disease
cge05323  Rheumatoid arthritis
cge05410  Hypertrophic cardiomyopathy
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773359 (Tgfb1)
   04350 TGF-beta signaling pathway
    100773359 (Tgfb1)
   04390 Hippo signaling pathway
    100773359 (Tgfb1)
   04068 FoxO signaling pathway
    100773359 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100773359 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100773359 (Tgfb1)
   04218 Cellular senescence
    100773359 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100773359 (Tgfb1)
   04672 Intestinal immune network for IgA production
    100773359 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100773359 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100773359 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773359 (Tgfb1)
   05205 Proteoglycans in cancer
    100773359 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100773359 (Tgfb1)
   05212 Pancreatic cancer
    100773359 (Tgfb1)
   05225 Hepatocellular carcinoma
    100773359 (Tgfb1)
   05226 Gastric cancer
    100773359 (Tgfb1)
   05220 Chronic myeloid leukemia
    100773359 (Tgfb1)
   05211 Renal cell carcinoma
    100773359 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100773359 (Tgfb1)
   05321 Inflammatory bowel disease
    100773359 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100773359 (Tgfb1)
   05414 Dilated cardiomyopathy
    100773359 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100773359 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100773359 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100773359 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773359 (Tgfb1)
   05161 Hepatitis B
    100773359 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100773359 (Tgfb1)
   05144 Malaria
    100773359 (Tgfb1)
   05145 Toxoplasmosis
    100773359 (Tgfb1)
   05140 Leishmaniasis
    100773359 (Tgfb1)
   05142 Chagas disease
    100773359 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cge03110]
    100773359 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100773359 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100773359 (Tgfb1)
Chaperones and folding catalysts [BR:cge03110]
 Intramolecular chaperones
  Others
   100773359 (Tgfb1)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100773359 (Tgfb1)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100773359 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100773359
NCBI-ProteinID: XP_027286179
LinkDB
Position
9
AA seq 390 aa
MPPSGLRLLPLLLPLPWLLVLTPGRPAVGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRSNPI
YDKTKDIPHSVYMFFNTSDIREAVPEPPLLSRAELRLQRFKSSVEQHVELYQKFSNNSWR
YLGNRLLSPTDTPEWLSFDVTAVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGIS
PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctcctgccgcttctgctcccgctgccgtggctcctggtg
ctgacgccggggaggccagccgtggggctctccacctgcaagaccatcgacatggagctg
gtgaaacgcaaacgcatcgaagccatccgtggccagatcctgtccaaactccggctcgcc
agccccccgagccagggggaggtgccgcccggcccgctgcccgaggccgtgctcgccctg
tacaacagcacccgcgaccgggtagcgggcgagagcgccgatccggagccggagcccgag
gcggactactacgccaaagaggtcacccgcgtgctgatggtggaccgcagcaacccaatc
tatgataaaaccaaagacatcccacacagtgtctatatgttcttcaatacgtcagacatt
agggaagcagtgcctgaacccccattgctgtcccgggcagagctgcgtctgcagagattc
aagtcaagtgtagaacaacacgtggaactctaccagaaattcagcaacaattcctggcgt
taccttggtaaccgactgctgtcccccaccgatacgccggagtggttgtcttttgatgtc
actgcggttgtacggcagtggctgaaccaaggagacgggatacagggctttcgcttcagt
gctcactgctcttgtgacagcaaagacaacgtactccacgtggaaatcaacgggatcagt
cccaaacgtcgaggtgacctgggcaccattcatgacatgaacagacccttcctgctcctc
atggccaccccgctggagagggcccagcacctgcacagctcaaggcatcgcagagccctg
gacaccaactactgcttcagctccacggagaagaactgctgtgtgcgacagctgtacatt
gactttcggaaggacctgggctggaagtggatccacgaacccaagggctaccatgccaac
ttctgtctggggccctgtccctacatttggagcctggacacacagtacagtaaggtcctc
gccctctacaaccaacacaacccgggtgcttcggcgtcaccgtgctgtgtgccacaggcg
ctggagccgctgcccatcgtgtactacgtgggtcgcaaacccaaggtggagcagttgtcc
aacatgatcgtccgctcctgcaagtgcagctga

KEGG   Cricetulus griseus (Chinese hamster): 100774918
Entry
100774918         CDS       T02813                                 

Gene name
Tgfb2
Definition
(RefSeq) transforming growth factor beta-2 proprotein isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04060  Cytokine-cytokine receptor interaction
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04218  Cellular senescence
cge04350  TGF-beta signaling pathway
cge04380  Osteoclast differentiation
cge04390  Hippo signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05144  Malaria
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05321  Inflammatory bowel disease
cge05323  Rheumatoid arthritis
cge05410  Hypertrophic cardiomyopathy
cge05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100774918 (Tgfb2)
   04350 TGF-beta signaling pathway
    100774918 (Tgfb2)
   04390 Hippo signaling pathway
    100774918 (Tgfb2)
   04068 FoxO signaling pathway
    100774918 (Tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100774918 (Tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100774918 (Tgfb2)
   04218 Cellular senescence
    100774918 (Tgfb2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100774918 (Tgfb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774918 (Tgfb2)
   05206 MicroRNAs in cancer
    100774918 (Tgfb2)
   05205 Proteoglycans in cancer
    100774918 (Tgfb2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100774918 (Tgfb2)
   05212 Pancreatic cancer
    100774918 (Tgfb2)
   05225 Hepatocellular carcinoma
    100774918 (Tgfb2)
   05226 Gastric cancer
    100774918 (Tgfb2)
   05220 Chronic myeloid leukemia
    100774918 (Tgfb2)
   05211 Renal cell carcinoma
    100774918 (Tgfb2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100774918 (Tgfb2)
   05321 Inflammatory bowel disease
    100774918 (Tgfb2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100774918 (Tgfb2)
   05414 Dilated cardiomyopathy
    100774918 (Tgfb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100774918 (Tgfb2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100774918 (Tgfb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100774918 (Tgfb2)
   05161 Hepatitis B
    100774918 (Tgfb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100774918 (Tgfb2)
   05144 Malaria
    100774918 (Tgfb2)
   05145 Toxoplasmosis
    100774918 (Tgfb2)
   05140 Leishmaniasis
    100774918 (Tgfb2)
   05142 Chagas disease
    100774918 (Tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cge04052]
    100774918 (Tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100774918 (Tgfb2)
Cytokines and growth factors [BR:cge04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100774918 (Tgfb2)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100774918 (Tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 100774918
NCBI-ProteinID: XP_027274539
LinkDB
Position
5
AA seq 442 aa
MHYCVLRTFLLLHLVPVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
DEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSHFPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSTMEKNASNLVKAEFRVF
RLQNPKARVAEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDSTSTYTSGDQKAIKSMRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHTKVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGNTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagaacctttttgctcctgcatctggtcccggtggcgctcagc
ctgtctacctgcagcaccctcgacatggaccagtttatgcgcaagaggatcgaagccatc
cgcgggcagatcctgagtaagctgaagctcaccagccccccggaagactaccctgagccg
gacgaggtccccccggaggtgatttccatatacaacagtaccagggacttactgcaggaa
aaggcaagccggagggcagctgcctgcgagcgagagcggagcgatgaagagtactacgct
aaggaggtttataaaatcgacatgccgtctcacttcccctccgaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttttgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgcttc
gatgtctcaacgatggagaagaatgcttctaatctagtgaaggcagagtttagagtcttt
cgtttgcagaaccccaaagccagggtggctgagcagcggatcgaactgtaccagatcctc
aaatcaaaagacttaacgtctccaacccagcgctacattgatagcaaggttgtgaaaacg
agagccgagggcgaatggctttccttcgacgtgacggacgccgtgcacgagtggctccac
cacaaagacaggaacctgggatttaagataagtctccactgcccctgctgcaccttcgtg
ccctctaacaattacatcatcccgaataagagtgaagagctcgaagccagatttgcaggt
attgatagcacctccacatataccagtggcgatcagaaagctataaagtccatgaggaaa
aaaaacagtgggaagacccctcatctcctgctaatgctgttgccctcctacagactggag
tcacaacagtccaaccggcggaagaagcgcgccttggatgctgcctattgcttcagaaat
gtgcaggataattgctgcctccgccctctttacattgatttcaagagggatcttgggtgg
aaatggatccatgaacccaaagggtacaacgccaacttctgtgctggggcatgcccctat
ctatggagttcagacactcagcacaccaaggtcctcagtttgtacaataccataaatcct
gaggcttctgcttccccttgctgtgtgtcccaagatctggagccactcaccatcctctac
tacattggcaacacacccaagatcgaacaactttccaacatgatcgtcaagtcttgtaaa
tgcagctaa

DBGET integrated database retrieval system