KEGG   Cricetulus griseus (Chinese hamster): 100757135Help
Entry
100757135         CDS       T02813                                 

Gene name
Galk1
Definition
(RefSeq) galactokinase isoform X2
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
Module
cge_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
cge_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100757135 (Galk1)
   00520 Amino sugar and nucleotide sugar metabolism
    100757135 (Galk1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757135 (Galk1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     100757135 (Galk1)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100757135 (Galk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 100757135
NCBI-ProteinID: XP_027281457
UniProt: A0A3L7HBS5
LinkDB All DBs
Position
7
AA seq 392 aa AA seqDB search
MAAWRPPKVEELLAEARRAFLEEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELV
TVLVGSPRTDGLVSLLTTSKNADEPQRLQFPLPTALRSLEPGTPQWANYVKGVIQHYPAA
PLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGAIAARAQVCQRAEHSFAGV
PCGIMDQLIALLGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHALGSSEYPIRR
RQCEEVAQALGKESLREVRFEELEAGRELISKEGFRRARHVVGEIRRTAQAAAALSRGDY
RAFGRLMVESHYSLRDDFEVSCPELDQLVEAALSVPGVYGSRMTGGGFGGCTVTLLEASA
ASLAMDHIQEQYSGTATFYLSQAADGAQVLSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggctgcttggagaccgcctaaggttgaggagctgctggccgaggcccggcgggccttc
ctggaggagttcggagctgagccggagctggccgtgtccgcgccgggccgcgtcaacctc
atcggggagcacacggactacaaccagggcctggtgctgcccatggctctggagcttgtg
accgtgctggttggcagcccccggacagatgggcttgtttctcttctcaccacctccaag
aatgcagatgagccccagcgactgcaattcccactgcccacagccctgcggtccttggag
cctggaaccccacaatgggccaattatgtcaagggagtgattcaacactacccagctgct
cccctccctggcttcagtgcagtggtggtcagctcagtgcccctggggggtgggctttcc
agctcagcttctctggaagtggccacctacaccttcctccagcagctctgcccagactcg
ggagccatagctgcccgggcccaggtgtgtcaacgggctgagcacagcttcgcaggggtg
ccctgtggcatcatggatcagctcatcgcactgctggggcagaaaggccatgcactactg
attgactgcaggtccctggaaacaagcctggtgcctctgtcagaccccaagctggctgtg
ctcatcactaactccaatgtccgccatgccctgggctccagtgagtatccgattcggcgg
cgccagtgtgaagaagtggcccaggctctgggcaaggagagccttcgagaggtgcggttc
gaggagcttgaggcgggcagggagctgataagcaaggaaggcttccggcgggcccggcac
gtggtaggcgagatccggcgaacagcccaggcagcggctgctctgagccgtggagactat
agggcctttgggcgtctcatggtggagagtcattactcactcagggatgactttgaggta
agttgccctgagctggaccaattggttgaggctgctctctcggtgcctggagtctatggc
agtcgcatgacaggtggtggctttggtggctgcacagtaacgttgctggaggcctctgct
gcttccctcgccatggatcacatacaggagcagtacagtggcacagccaccttctacctc
tctcaagctgccgacggagcccaggtgctgagcctgtga

DBGET integrated database retrieval system