KEGG   Cricetulus griseus (Chinese hamster): 100757521
Entry
100757521         CDS       T02813                                 

Gene name
Sos1
Definition
(RefSeq) son of sevenless homolog 1 isoform X2
  KO
K03099  son of sevenless
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04072  Phospholipase D signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04510  Focal adhesion
cge04540  Gap junction
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04722  Neurotrophin signaling pathway
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100757521 (Sos1)
   04012 ErbB signaling pathway
    100757521 (Sos1)
   04014 Ras signaling pathway
    100757521 (Sos1)
   04630 JAK-STAT signaling pathway
    100757521 (Sos1)
   04068 FoxO signaling pathway
    100757521 (Sos1)
   04072 Phospholipase D signaling pathway
    100757521 (Sos1)
   04151 PI3K-Akt signaling pathway
    100757521 (Sos1)
   04150 mTOR signaling pathway
    100757521 (Sos1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100757521 (Sos1)
   04540 Gap junction
    100757521 (Sos1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100757521 (Sos1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100757521 (Sos1)
   04660 T cell receptor signaling pathway
    100757521 (Sos1)
   04662 B cell receptor signaling pathway
    100757521 (Sos1)
   04664 Fc epsilon RI signaling pathway
    100757521 (Sos1)
   04062 Chemokine signaling pathway
    100757521 (Sos1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100757521 (Sos1)
   04912 GnRH signaling pathway
    100757521 (Sos1)
   04915 Estrogen signaling pathway
    100757521 (Sos1)
   04917 Prolactin signaling pathway
    100757521 (Sos1)
   04926 Relaxin signaling pathway
    100757521 (Sos1)
   04935 Growth hormone synthesis, secretion and action
    100757521 (Sos1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100757521 (Sos1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100757521 (Sos1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100757521 (Sos1)
   05206 MicroRNAs in cancer
    100757521 (Sos1)
   05205 Proteoglycans in cancer
    100757521 (Sos1)
   05231 Choline metabolism in cancer
    100757521 (Sos1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100757521 (Sos1)
   05225 Hepatocellular carcinoma
    100757521 (Sos1)
   05226 Gastric cancer
    100757521 (Sos1)
   05214 Glioma
    100757521 (Sos1)
   05221 Acute myeloid leukemia
    100757521 (Sos1)
   05220 Chronic myeloid leukemia
    100757521 (Sos1)
   05211 Renal cell carcinoma
    100757521 (Sos1)
   05215 Prostate cancer
    100757521 (Sos1)
   05213 Endometrial cancer
    100757521 (Sos1)
   05224 Breast cancer
    100757521 (Sos1)
   05223 Non-small cell lung cancer
    100757521 (Sos1)
  09165 Substance dependence
   05034 Alcoholism
    100757521 (Sos1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100757521 (Sos1)
   05160 Hepatitis C
    100757521 (Sos1)
   05163 Human cytomegalovirus infection
    100757521 (Sos1)
   05165 Human papillomavirus infection
    100757521 (Sos1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100757521 (Sos1)
   01522 Endocrine resistance
    100757521 (Sos1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cge04990]
    100757521 (Sos1)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100757521 (Sos1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 100757521
NCBI-ProteinID: XP_027281798
LinkDB
Position
7
AA seq 1319 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPAERIHHLLREVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSSY
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDESSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQILKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECVKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTSEYKHAFEIILKDGNSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENILFEENVQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLNLIIERFEIPEPEPTEADR
IALENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGPNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESAASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSASPFHSRSASVSSISLAKGTDEVPVPPPVP
PRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSLSDRTSVSDPPESPPLL
PPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLP
SPPLTQDVDLHSIAGPPVPPRQSTSQLIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
NT seq 3960 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaggagaacgcgcccaagtggcgg
gggctgctggtgccggcgctgaaaaaggttcaggggcaagttcatcctactcttgagtcc
aatgatgatgctcttcagtatgttgaagaattaattttgcaattattaaatatgctatgc
caagctcagccccggagtgcttcagatgtggaggaacgtgttcaaaaaagtttccctcat
ccaattgataagtgggcaatagctgatgcccaatcagctattgaaaagaggaagagaaga
aatcctttatctctgccagcagaaagaattcatcatttattaagggaggttctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtattagaatatatttctgcagat
attttaaagctggtggggaattatgtaagaaatatacggcattatgaaattacaaaacaa
gacattaaagtggcaatgtgtgctgataaggtattgatggatatgtttcatcaagatgta
gaagacataaatatcttatctttaactgatgaagagccttccacctcaggagaacaaact
tattatgatttggtaaaagcattcatggcagaaattcgacaatatataagagaattaaat
ctaattataaaagtttttcgagaaccctttgtctccaattccaaattgttttcatcttat
gatgtagaaaacatatttagtcgtatagtagatatacatgaacttagtgtaaagttactg
ggccatatagaagacactgtagagatgacagatgaaagcagtccccacccattagtagga
agctgttttgaagacttagcagaggaactagcatttgacccatatgaatcatatgctcgg
gatattttacggccaggattccatgatcgtttccttagtcagatattaaagcctggggca
gcactttatttgcagtcgataggcgaaggcttcaaagaagctgtgcagtatgtgctgcct
cggctgctgctggcccccgtgtaccactgtctgcactactttgagcttctaaagcagtta
gaagaaaagagcgaagatcaagaagacaaggaatgtgtgaaacaagcaataacagctctg
cttaatgtccaaagtggcatggaaaaaatatgctccaaaagtcttgcgaagcgaagactg
agtgagtctgcatgtcgattttatagccagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggaggggaaagacattggacagtgt
tgcaatgagttcataatggaaggaactcttacacgtgtaggagccaagcatgagagacac
atatttctcttcgatggcttaatgatttgctgtaaatcaaatcatgggcagccgagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccagtgaatacaagcatgcttttgaaataattctgaaagat
ggaaatagtgttatattttctgccaagtcagctgaagagaaaaacaactggatggcagca
ctgatatctttgcagtaccggagtaccctggagcgaatgctcgatgtaacgatgcttcag
gaagagaaggaggagcagatgaggctgcctagtgctgatgtgtacaggtttgcagagcca
gactctgaggagaatattctgtttgaagagaacgtgcagcccaaggctgggattccaatt
atcaaagcagggactgtgattaagctgatcgagaggcttacataccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaagaacta
ctgaatcttataatagaacgatttgaaattccggagcctgagccaacagaagctgatcga
atagctctagaaaatggagatcagccactgagtgcagagctgaagaggtttagaaaggag
tacattcagcctgtccagctgcgagtgttaaatgtgtgtcggcactgggtggagcaccat
ttttatgactttgaaagagatgcagaccttttacaaagaatggaggaatttattggaact
gtaagaggtaaagcaatgaaaaaatgggtcgaatccatcactaagataatccaaaggaaa
aaaattgcaagagacaatggcccaggtcctaatattacatttcagagctcacctcccaca
gttgagtggcacataagcagacctgggcacatagagacttttgacttgctcaccttacac
ccaatagaaattgctcggcaactcactttgcttgaatcagatctataccgagctgtgcag
ccgtcagaattagttggaagtgtgtggacaaaagaagataaagaaattaattctcccaac
cttctgaaaatgatacgacacactactaacctcactctgtggtttgaaaaatgtattgta
gaaacagaaaacttagaagaaagagtagctgtggtgagtcggataattgagattctacaa
gtctttcaagaactgaacaacttcaatggtgtccttgaggttgtcagtgctatgaactca
tcccctgtttacaggctagaccacacatttgagcaaataccaagtagacaaaagaaaatt
ttagaagaagctcatgagttgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatatatctcactaatatcttaaaaaca
gaagaaggcaaccctgaagtcctgaaaagacatgggaaagagctcatcaacttcagcaaa
aggaggaaagtggcagagataacgggggagatccagcagtaccaaaaccagccttactgt
ttacgggtggagtcagatatcaaaaggttctttgaaaacttgaatccaatgggaaatagc
atggagaaagaatttacagactatcttttcaacaaatccctagaaatagaaccacggaac
cctaagcctcttccaagatttccaaaaaaatacagctatcctctaaaatcccctggtgtc
cgtccgtcaaacccaagaccaggaaccatgaggcaccccacacctctgcagcaggagcca
agaaaaattagttacagcaggatccctgaaagtgagactgaaagtgcagcctctgcaccc
aattctccaagaacgccactgacacctcctcctgcgtccggtgcttccagtaccacggat
gtttgcagcgtgtttgattctgaccattcagcaagcccttttcactcaagatctgcttct
gtctcatctataagtttagccaagggcactgatgaagtgcccgtcccccctcctgttccc
cctcgaagaaggccagaatctgccccagcagaatcatccccatctaagattatgtctaag
cacttggacagccccccagctattcctcctaggcaacccacatcaaaagcctattcacca
agatactcactctcagatcggacctctgtatcagaccctcctgaaagccctcccttgtta
ccaccacgagaacctgtgaggacacctgatgttttctcaagctcaccattacatctccaa
cctccccctttgggcaaaaagagtgatcatggcaatgccttcttcccaaatagcccttct
ccctttacaccacctcctcctcaaactccttctcctcatggcacaagaaggcatctgcca
tcgccaccgctgacacaggacgtggacctccattccattgctgggcctcctgttcctcca
cgacaaagcacttctcaacttatccctaaacttcctccaaaaacttacaagagggagcac
acacacccttccatgcacagagatggaccacctctgttggagaatgcccattcttcctga

KEGG   Cricetulus griseus (Chinese hamster): 100769325
Entry
100769325         CDS       T02813                                 

Gene name
Sos2
Definition
(RefSeq) son of sevenless homolog 2 isoform X3
  KO
K03099  son of sevenless
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04072  Phospholipase D signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04510  Focal adhesion
cge04540  Gap junction
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04722  Neurotrophin signaling pathway
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100769325 (Sos2)
   04012 ErbB signaling pathway
    100769325 (Sos2)
   04014 Ras signaling pathway
    100769325 (Sos2)
   04630 JAK-STAT signaling pathway
    100769325 (Sos2)
   04068 FoxO signaling pathway
    100769325 (Sos2)
   04072 Phospholipase D signaling pathway
    100769325 (Sos2)
   04151 PI3K-Akt signaling pathway
    100769325 (Sos2)
   04150 mTOR signaling pathway
    100769325 (Sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100769325 (Sos2)
   04540 Gap junction
    100769325 (Sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100769325 (Sos2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100769325 (Sos2)
   04660 T cell receptor signaling pathway
    100769325 (Sos2)
   04662 B cell receptor signaling pathway
    100769325 (Sos2)
   04664 Fc epsilon RI signaling pathway
    100769325 (Sos2)
   04062 Chemokine signaling pathway
    100769325 (Sos2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100769325 (Sos2)
   04912 GnRH signaling pathway
    100769325 (Sos2)
   04915 Estrogen signaling pathway
    100769325 (Sos2)
   04917 Prolactin signaling pathway
    100769325 (Sos2)
   04926 Relaxin signaling pathway
    100769325 (Sos2)
   04935 Growth hormone synthesis, secretion and action
    100769325 (Sos2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100769325 (Sos2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100769325 (Sos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769325 (Sos2)
   05206 MicroRNAs in cancer
    100769325 (Sos2)
   05205 Proteoglycans in cancer
    100769325 (Sos2)
   05231 Choline metabolism in cancer
    100769325 (Sos2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100769325 (Sos2)
   05225 Hepatocellular carcinoma
    100769325 (Sos2)
   05226 Gastric cancer
    100769325 (Sos2)
   05214 Glioma
    100769325 (Sos2)
   05221 Acute myeloid leukemia
    100769325 (Sos2)
   05220 Chronic myeloid leukemia
    100769325 (Sos2)
   05211 Renal cell carcinoma
    100769325 (Sos2)
   05215 Prostate cancer
    100769325 (Sos2)
   05213 Endometrial cancer
    100769325 (Sos2)
   05224 Breast cancer
    100769325 (Sos2)
   05223 Non-small cell lung cancer
    100769325 (Sos2)
  09165 Substance dependence
   05034 Alcoholism
    100769325 (Sos2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100769325 (Sos2)
   05160 Hepatitis C
    100769325 (Sos2)
   05163 Human cytomegalovirus infection
    100769325 (Sos2)
   05165 Human papillomavirus infection
    100769325 (Sos2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100769325 (Sos2)
   01522 Endocrine resistance
    100769325 (Sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cge04990]
    100769325 (Sos2)
Domain-containing proteins not elsewhere classified [BR:cge04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100769325 (Sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 100769325
NCBI-ProteinID: XP_027273959
LinkDB
Position
5
AA seq 1332 aa
MQQAPQPYEFFSEENSPKWRGLLVPALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
DIGLVSLCEDEPSSSGELNYYDLVRTEIAEERQYLRELNMIIKVFREAFLSDRKLFKPSE
IEKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQD
ILSPEFNDHFSKLMARPAVALHFQSIAEGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLK
ARSEEQEDKECLNQAITALMNLQGSMDRIYKQHSPRRRPGDSVCLFYNRQLRSKHLAIKK
MNEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHCQTRLP
GYSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSVIFVAKSAEEKNNWMAAL
ISLHYRSTLDRMLDSVLLKEENEQPLRLPSPDVYRFVVKDSEENIVFEDNLQSRSGIPII
KGGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTEADKL
ALEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSV
RGKAMKKWVESIAKIIKRKKQAQANGISHNITFESPPPPIEWHISRPGQFETFDLMTLHP
IEIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVE
AENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRRIL
DDAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKR
RKVAEITGEIQQYQNQPYCLRTEPEMRRFFENLNPMGILSEKEFTDYLFNKSLEIEPRNC
KQPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPYKISFSRIAETELDST
VSAPTSPNTPSTPPVSASSDHSVFLDVDLNSSCGSNTIFAPVLLPQSKTFFSSCGSLHKL
SEEPLIPPPLPPRKKVDHDASNSKGTMKSDDPPAIPPRQPPPPKIKPRVPVPTGAFDGPV
HSPPPPPPREPLPDTPPPVPLRPPEHFINCPFNLQPPPLGHPHRDPDWLRDVSTCPNSPS
TPPSTPSPRVPRRSHLLSSSHNNLTHPPAPPVPPRQNSSPHLPKLPPKTYKRELSHPPLY
RLPLLENAETPQ
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcagcaggcgccgcagccctacgagttcttcagcgaagaaaacagcccgaaatggcgg
ggactgttggtcccggccctgcggaaggttcaggagcaagtacatcctaccctttcagct
aatgaagaatccctttattacattgaagaactgatttttcagctgcttaataaattatgc
atggctcaaccaaggactgttcaagatgtggaggaaagagtacaaaagacctttcctcat
cccattgataaatgggcaattgctgatgcacagtctgccatcgagaaacggaaacgaaga
aatcctcttttactacctgtggataaaatccatccttctttgaaggaagttttggggtac
aaagtggactaccatgtgtccctctacattgtggccgtattggagtatatctcagcagat
attttgaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcaa
gacattaaagtgtcaatgtgtgcagataaggttctgatggacatgtttgatcaggatgat
gacataggtttggtttctctctgtgaagatgaaccaagttcttctggtgagctaaactat
tatgaccttgtccgaactgaaattgcagaagaaagacagtatctacgggagctgaatatg
atcatcaaagtattccgggaagcctttctttctgacagaaagttgttcaagccttctgaa
attgaaaagattttcagtaacatttcagatatacatgaattgactgtgaaacttttaggt
ttaattgaagacacagtagaaatgacagatgaaagtagtcctcatccattagctggtagc
tgttttgaagatttagctgaggagcaagcatttgatccctatgaaacattatcacaggac
attctttcaccagagtttaatgaccactttagtaagttgatggccagacctgcagttgct
ctacattttcagtccattgctgaaggctttaaggaggccgttcgctatgtcctcccacgt
ctcatgctggtgcccgtgtatcattgctggcattactttgaattattaaagcagctgaaa
gcacgtagtgaagaacaggaagacaaagaatgtttgaatcaggctatcactgccctcatg
aatctccaaggcagcatggaccgaatttacaagcagcattcacctagacgccgaccaggg
gattctgtttgcctgttttacaatcgtcaattaagaagcaagcacctggctatcaaaaaa
atgaatgaaattcagaaaaacatagatgggtgggaaggcaaagatattggacagtgttgt
aacgagttcataatggaagggccattgaccagaattggtgctaaacatgagcggcatatt
tttctctttgatggcttgatgatcagctgtaaacctaatcattgccagacccgacttcca
ggttatagtagtgcagaatacagattaaaagagaagtttgtcatgaggaaaattcaaatc
tgtgataaagaagatacttgtgaatacaaacatgcttttgaattagtatccaaagatgaa
aacagtgtaatatttgttgccaagtcagctgaagagaagaataattggatggcagccctt
atttcccttcactaccgaagtactctagatagaatgctggattctgtactgttgaaagaa
gaaaatgagcagccactgaggttgccaagtccagatgtataccgctttgtggtaaaagac
tcggaggaaaacattgtttttgaagacaacttacagagtagaagtggaatccccattatt
aaaggagggactgtggtgaaattaattgagaggctgacatatcatatgtatgcagatccc
aattttgttcgtacttttcttactacatatcgctcattttgtaaaccacaggaattgcta
agcttgctgatagagcggtttgaaattcctgaaccagaacctactgaggcagacaaattg
gcactagagaaaggcgagcaaccaatcagtgcagatctgaaaagatttcgcaaggaatat
gtccagcctgtgcaactcaggatcttaaatgtctttcgccactgggttgaacatcatttt
tatgactttgaaagagacctggaattgcttgaaagactagaatccttcatttcaagtgta
agagggaaagctatgaagaaatgggtagagtccattgctaaaatcatcaagaggaaaaag
caagctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaatt
gagtggcatataagtagaccaggccagtttgaaacatttgatcttatgacccttcatcca
atagaaattgcacgtcagttaacacttttggaatctgatctctacaggaaagtacaacct
tctgaacttgtagggagtgtctggaccaaagaagataaagaaataaattctccaaactta
ttaaaaatgattcgtcatacaacaaacctcacactctggtttgagaaatgcattgtggaa
gcagaaaattttgaagagcgagtggcagtgctcagtagaataatagaaattctgcaagtg
tttcaagatttgaataatttcaatggcgtgttggaaatagtcagtgcggtcaattcggta
tcagtgtacagactagaccacacatttgaggcattgcaggaaaggaagaggagaattctg
gatgatgctgtagaattaagtcaggaccactttaagaaatatctagtgaaactgaagtca
atcaacccaccatgtgtgcctttttttggaatatatttaacaaatattctgaagactgaa
gaagggaacaatgattttctaaagaagaaagggaaagatttgatcaattttagtaagagg
aggaaagtggctgaaattactggagaaattcagcagtatcagaaccagccgtactgctta
cggacagaaccagaaatgaggagattctttgaaaaccttaaccccatgggaattttatct
gaaaaagagtttacagattatttgttcaacaagtcactagagatagaaccgagaaactgc
aaacagccacctcgatttcctaggaaatcaaccttttccttaaaatctcctggaataagg
cctaacacaggccgacatggctctacctcaggcacattacgaggtcacccgacacctttg
gaaagagaaccgtataagataagctttagcaggatcgctgagaccgagcttgactcaaca
gtgtcagcacccacctctccaaacacaccgtccactccccctgtgtctgcttcttcagac
cacagcgtgtttctagacgtggatctcaatagttcctgtggcagtaataccatctttgct
ccagtcctcttgccccagtcaaagactttcttcagctcatgtggaagtttacacaaactg
agtgaagagccactgattcctcctccacttcctcctcgaaaaaaagttgaccatgatgct
tcaaattccaagggaactatgaaatctgatgaccctcctgctatcccaccaagacagcct
cctcctccgaagataaagccaagagttcctgtccccactggtgcgtttgatgggcctgtg
cacagtccacctccacctcctccaagagagcctcttcctgacacccctccaccagttcct
cttcggcctccagaacattttataaactgtccatttaatcttcagccacctccactggga
catcctcacagagacccagactggctcagagacgttagtacatgtccaaattcaccaagc
actcctcccagcacaccctctccacgagtgccacgcagaagccatttgctcagttccagt
cacaacaatctcactcatcctccagctcctcctgttccaccaaggcagaattcaagccct
cacctgcccaaactgccaccaaagacctacaaacgggaactttcacacccaccattgtac
agactgcctttgcttgaaaatgcagaaactcctcaatga

DBGET integrated database retrieval system