KEGG   Cricetulus griseus (Chinese hamster): 100757614
Entry
100757614         CDS       T02813                                 

Gene name
Nras
Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100757614 (Nras)
   04012 ErbB signaling pathway
    100757614 (Nras)
   04014 Ras signaling pathway
    100757614 (Nras)
   04015 Rap1 signaling pathway
    100757614 (Nras)
   04370 VEGF signaling pathway
    100757614 (Nras)
   04371 Apelin signaling pathway
    100757614 (Nras)
   04068 FoxO signaling pathway
    100757614 (Nras)
   04072 Phospholipase D signaling pathway
    100757614 (Nras)
   04071 Sphingolipid signaling pathway
    100757614 (Nras)
   04151 PI3K-Akt signaling pathway
    100757614 (Nras)
   04150 mTOR signaling pathway
    100757614 (Nras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100757614 (Nras)
   04137 Mitophagy - animal
    100757614 (Nras)
  09143 Cell growth and death
   04210 Apoptosis
    100757614 (Nras)
   04218 Cellular senescence
    100757614 (Nras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100757614 (Nras)
   04550 Signaling pathways regulating pluripotency of stem cells
    100757614 (Nras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100757614 (Nras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100757614 (Nras)
   04650 Natural killer cell mediated cytotoxicity
    100757614 (Nras)
   04660 T cell receptor signaling pathway
    100757614 (Nras)
   04662 B cell receptor signaling pathway
    100757614 (Nras)
   04664 Fc epsilon RI signaling pathway
    100757614 (Nras)
   04062 Chemokine signaling pathway
    100757614 (Nras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100757614 (Nras)
   04929 GnRH secretion
    100757614 (Nras)
   04912 GnRH signaling pathway
    100757614 (Nras)
   04915 Estrogen signaling pathway
    100757614 (Nras)
   04917 Prolactin signaling pathway
    100757614 (Nras)
   04921 Oxytocin signaling pathway
    100757614 (Nras)
   04926 Relaxin signaling pathway
    100757614 (Nras)
   04935 Growth hormone synthesis, secretion and action
    100757614 (Nras)
   04919 Thyroid hormone signaling pathway
    100757614 (Nras)
   04916 Melanogenesis
    100757614 (Nras)
  09156 Nervous system
   04725 Cholinergic synapse
    100757614 (Nras)
   04726 Serotonergic synapse
    100757614 (Nras)
   04720 Long-term potentiation
    100757614 (Nras)
   04730 Long-term depression
    100757614 (Nras)
   04722 Neurotrophin signaling pathway
    100757614 (Nras)
  09158 Development and regeneration
   04360 Axon guidance
    100757614 (Nras)
  09149 Aging
   04211 Longevity regulating pathway
    100757614 (Nras)
   04213 Longevity regulating pathway - multiple species
    100757614 (Nras)
  09159 Environmental adaptation
   04714 Thermogenesis
    100757614 (Nras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100757614 (Nras)
   05206 MicroRNAs in cancer
    100757614 (Nras)
   05205 Proteoglycans in cancer
    100757614 (Nras)
   05203 Viral carcinogenesis
    100757614 (Nras)
   05230 Central carbon metabolism in cancer
    100757614 (Nras)
   05231 Choline metabolism in cancer
    100757614 (Nras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100757614 (Nras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100757614 (Nras)
   05225 Hepatocellular carcinoma
    100757614 (Nras)
   05226 Gastric cancer
    100757614 (Nras)
   05214 Glioma
    100757614 (Nras)
   05216 Thyroid cancer
    100757614 (Nras)
   05221 Acute myeloid leukemia
    100757614 (Nras)
   05220 Chronic myeloid leukemia
    100757614 (Nras)
   05218 Melanoma
    100757614 (Nras)
   05211 Renal cell carcinoma
    100757614 (Nras)
   05219 Bladder cancer
    100757614 (Nras)
   05215 Prostate cancer
    100757614 (Nras)
   05213 Endometrial cancer
    100757614 (Nras)
   05224 Breast cancer
    100757614 (Nras)
   05223 Non-small cell lung cancer
    100757614 (Nras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100757614 (Nras)
   05022 Pathways of neurodegeneration - multiple diseases
    100757614 (Nras)
  09165 Substance dependence
   05034 Alcoholism
    100757614 (Nras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100757614 (Nras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100757614 (Nras)
   05170 Human immunodeficiency virus 1 infection
    100757614 (Nras)
   05161 Hepatitis B
    100757614 (Nras)
   05160 Hepatitis C
    100757614 (Nras)
   05163 Human cytomegalovirus infection
    100757614 (Nras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100757614 (Nras)
   05165 Human papillomavirus infection
    100757614 (Nras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100757614 (Nras)
   01522 Endocrine resistance
    100757614 (Nras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100757614 (Nras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757614 (Nras)
   04031 GTP-binding proteins [BR:cge04031]
    100757614 (Nras)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100757614 (Nras)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100757614 (Nras)
  Exosomal proteins of other body fluids (saliva and urine)
   100757614 (Nras)
  Exosomal proteins of breast cancer cells
   100757614 (Nras)
  Exosomal proteins of colorectal cancer cells
   100757614 (Nras)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100757614 (Nras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N
Other DBs
NCBI-GeneID: 100757614
NCBI-ProteinID: XP_027249625
UniProt: A0A061INW8
LinkDB
Position
1
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgctttgaca
atccagttaatccagaaccactttgtggatgaatatgatcccaccatagaggattcttac
cgaaaacaagtggtaattgatggtgagacttgtctgttggacatactggacacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggattcctctgt
gtatttgccatcaacaatagcaaatcatttgcagatattaacctctacagagagcagatt
aaacgagtgaaagactctgatgatgtgcctatggtgctggtcgggaacaaatgtgacttg
ccaacaaggacagttgacacaaagcaagcccatgagctggccaagagttatggaattcca
ttcattgaaacctcagccaagacccgacagggtgtggaagatgccttttacacactagta
agggagatacgccagtaccgaatgaaaaagctcaacagcaatgatgatggcactcaaggt
tgtatggggttgccctgtgtggtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100763178
Entry
100763178         CDS       T02813                                 

Gene name
Kras
Definition
(RefSeq) GTPase KRas isoform X4
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100763178 (Kras)
   04012 ErbB signaling pathway
    100763178 (Kras)
   04014 Ras signaling pathway
    100763178 (Kras)
   04015 Rap1 signaling pathway
    100763178 (Kras)
   04370 VEGF signaling pathway
    100763178 (Kras)
   04371 Apelin signaling pathway
    100763178 (Kras)
   04068 FoxO signaling pathway
    100763178 (Kras)
   04072 Phospholipase D signaling pathway
    100763178 (Kras)
   04071 Sphingolipid signaling pathway
    100763178 (Kras)
   04151 PI3K-Akt signaling pathway
    100763178 (Kras)
   04150 mTOR signaling pathway
    100763178 (Kras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100763178 (Kras)
   04137 Mitophagy - animal
    100763178 (Kras)
  09143 Cell growth and death
   04210 Apoptosis
    100763178 (Kras)
   04218 Cellular senescence
    100763178 (Kras)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100763178 (Kras)
   04550 Signaling pathways regulating pluripotency of stem cells
    100763178 (Kras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100763178 (Kras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100763178 (Kras)
   04650 Natural killer cell mediated cytotoxicity
    100763178 (Kras)
   04660 T cell receptor signaling pathway
    100763178 (Kras)
   04662 B cell receptor signaling pathway
    100763178 (Kras)
   04664 Fc epsilon RI signaling pathway
    100763178 (Kras)
   04062 Chemokine signaling pathway
    100763178 (Kras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100763178 (Kras)
   04929 GnRH secretion
    100763178 (Kras)
   04912 GnRH signaling pathway
    100763178 (Kras)
   04915 Estrogen signaling pathway
    100763178 (Kras)
   04914 Progesterone-mediated oocyte maturation
    100763178 (Kras)
   04917 Prolactin signaling pathway
    100763178 (Kras)
   04921 Oxytocin signaling pathway
    100763178 (Kras)
   04926 Relaxin signaling pathway
    100763178 (Kras)
   04935 Growth hormone synthesis, secretion and action
    100763178 (Kras)
   04919 Thyroid hormone signaling pathway
    100763178 (Kras)
   04916 Melanogenesis
    100763178 (Kras)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100763178 (Kras)
  09156 Nervous system
   04725 Cholinergic synapse
    100763178 (Kras)
   04726 Serotonergic synapse
    100763178 (Kras)
   04720 Long-term potentiation
    100763178 (Kras)
   04730 Long-term depression
    100763178 (Kras)
   04722 Neurotrophin signaling pathway
    100763178 (Kras)
  09158 Development and regeneration
   04360 Axon guidance
    100763178 (Kras)
  09149 Aging
   04211 Longevity regulating pathway
    100763178 (Kras)
   04213 Longevity regulating pathway - multiple species
    100763178 (Kras)
  09159 Environmental adaptation
   04714 Thermogenesis
    100763178 (Kras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100763178 (Kras)
   05206 MicroRNAs in cancer
    100763178 (Kras)
   05205 Proteoglycans in cancer
    100763178 (Kras)
   05203 Viral carcinogenesis
    100763178 (Kras)
   05230 Central carbon metabolism in cancer
    100763178 (Kras)
   05231 Choline metabolism in cancer
    100763178 (Kras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100763178 (Kras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100763178 (Kras)
   05212 Pancreatic cancer
    100763178 (Kras)
   05225 Hepatocellular carcinoma
    100763178 (Kras)
   05226 Gastric cancer
    100763178 (Kras)
   05214 Glioma
    100763178 (Kras)
   05216 Thyroid cancer
    100763178 (Kras)
   05221 Acute myeloid leukemia
    100763178 (Kras)
   05220 Chronic myeloid leukemia
    100763178 (Kras)
   05218 Melanoma
    100763178 (Kras)
   05211 Renal cell carcinoma
    100763178 (Kras)
   05219 Bladder cancer
    100763178 (Kras)
   05215 Prostate cancer
    100763178 (Kras)
   05213 Endometrial cancer
    100763178 (Kras)
   05224 Breast cancer
    100763178 (Kras)
   05223 Non-small cell lung cancer
    100763178 (Kras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100763178 (Kras)
   05022 Pathways of neurodegeneration - multiple diseases
    100763178 (Kras)
  09165 Substance dependence
   05034 Alcoholism
    100763178 (Kras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100763178 (Kras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100763178 (Kras)
   05170 Human immunodeficiency virus 1 infection
    100763178 (Kras)
   05161 Hepatitis B
    100763178 (Kras)
   05160 Hepatitis C
    100763178 (Kras)
   05163 Human cytomegalovirus infection
    100763178 (Kras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100763178 (Kras)
   05165 Human papillomavirus infection
    100763178 (Kras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100763178 (Kras)
   01522 Endocrine resistance
    100763178 (Kras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100763178 (Kras)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    100763178 (Kras)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100763178 (Kras)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100763178 (Kras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MeaB G-alpha FeoB_N Gtr1_RagA ATP_bind_1 Septin NPR1_interact ParA CbiA
Other DBs
NCBI-GeneID: 100763178
NCBI-ProteinID: XP_027285922
LinkDB
Position
8
AA seq 198 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKK
SKTKCIIIASIPWVLDFN
NT seq 597 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctggtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
cgagaaattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattattgccagtattccctgggttttggacttcaactag

KEGG   Cricetulus griseus (Chinese hamster): 100771078
Entry
100771078         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X2
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100771078
   04012 ErbB signaling pathway
    100771078
   04014 Ras signaling pathway
    100771078
   04015 Rap1 signaling pathway
    100771078
   04370 VEGF signaling pathway
    100771078
   04371 Apelin signaling pathway
    100771078
   04068 FoxO signaling pathway
    100771078
   04072 Phospholipase D signaling pathway
    100771078
   04071 Sphingolipid signaling pathway
    100771078
   04151 PI3K-Akt signaling pathway
    100771078
   04150 mTOR signaling pathway
    100771078
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100771078
   04137 Mitophagy - animal
    100771078
  09143 Cell growth and death
   04210 Apoptosis
    100771078
   04218 Cellular senescence
    100771078
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100771078
   04550 Signaling pathways regulating pluripotency of stem cells
    100771078
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100771078
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100771078
   04650 Natural killer cell mediated cytotoxicity
    100771078
   04660 T cell receptor signaling pathway
    100771078
   04662 B cell receptor signaling pathway
    100771078
   04664 Fc epsilon RI signaling pathway
    100771078
   04062 Chemokine signaling pathway
    100771078
  09152 Endocrine system
   04910 Insulin signaling pathway
    100771078
   04929 GnRH secretion
    100771078
   04912 GnRH signaling pathway
    100771078
   04915 Estrogen signaling pathway
    100771078
   04914 Progesterone-mediated oocyte maturation
    100771078
   04917 Prolactin signaling pathway
    100771078
   04921 Oxytocin signaling pathway
    100771078
   04926 Relaxin signaling pathway
    100771078
   04935 Growth hormone synthesis, secretion and action
    100771078
   04919 Thyroid hormone signaling pathway
    100771078
   04916 Melanogenesis
    100771078
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100771078
  09156 Nervous system
   04725 Cholinergic synapse
    100771078
   04726 Serotonergic synapse
    100771078
   04720 Long-term potentiation
    100771078
   04730 Long-term depression
    100771078
   04722 Neurotrophin signaling pathway
    100771078
  09158 Development and regeneration
   04360 Axon guidance
    100771078
  09149 Aging
   04211 Longevity regulating pathway
    100771078
   04213 Longevity regulating pathway - multiple species
    100771078
  09159 Environmental adaptation
   04714 Thermogenesis
    100771078
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100771078
   05206 MicroRNAs in cancer
    100771078
   05205 Proteoglycans in cancer
    100771078
   05203 Viral carcinogenesis
    100771078
   05230 Central carbon metabolism in cancer
    100771078
   05231 Choline metabolism in cancer
    100771078
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100771078
  09162 Cancer: specific types
   05210 Colorectal cancer
    100771078
   05212 Pancreatic cancer
    100771078
   05225 Hepatocellular carcinoma
    100771078
   05226 Gastric cancer
    100771078
   05214 Glioma
    100771078
   05216 Thyroid cancer
    100771078
   05221 Acute myeloid leukemia
    100771078
   05220 Chronic myeloid leukemia
    100771078
   05218 Melanoma
    100771078
   05211 Renal cell carcinoma
    100771078
   05219 Bladder cancer
    100771078
   05215 Prostate cancer
    100771078
   05213 Endometrial cancer
    100771078
   05224 Breast cancer
    100771078
   05223 Non-small cell lung cancer
    100771078
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100771078
   05022 Pathways of neurodegeneration - multiple diseases
    100771078
  09165 Substance dependence
   05034 Alcoholism
    100771078
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100771078
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100771078
   05170 Human immunodeficiency virus 1 infection
    100771078
   05161 Hepatitis B
    100771078
   05160 Hepatitis C
    100771078
   05163 Human cytomegalovirus infection
    100771078
   05167 Kaposi sarcoma-associated herpesvirus infection
    100771078
   05165 Human papillomavirus infection
    100771078
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100771078
   01522 Endocrine resistance
    100771078
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100771078
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    100771078
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100771078
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100771078
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N Septin PAG NPR1_interact Hpr_kinase_C
Other DBs
NCBI-GeneID: 100771078
NCBI-ProteinID: XP_035309618
LinkDB
Position
Unknown
AA seq 188 aa
MNEYKLVVVGADGVGKSALTIQLIQNHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRAKDSEDVPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRNHKEKMSKDGKKKKKK
SKTKCITM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaatgaatataaacttgtggttgttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagcaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacaccaatcaggctcaggacttagcaggaagttatgggattccg
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattagtc
cgagaaattcgaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataactatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100773737
Entry
100773737         CDS       T02813                                 

Gene name
Hras
Definition
(RefSeq) GTPase HRas isoform X2
  KO
K02833  GTPase HRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04144  Endocytosis
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773737 (Hras)
   04012 ErbB signaling pathway
    100773737 (Hras)
   04014 Ras signaling pathway
    100773737 (Hras)
   04015 Rap1 signaling pathway
    100773737 (Hras)
   04370 VEGF signaling pathway
    100773737 (Hras)
   04371 Apelin signaling pathway
    100773737 (Hras)
   04630 JAK-STAT signaling pathway
    100773737 (Hras)
   04068 FoxO signaling pathway
    100773737 (Hras)
   04072 Phospholipase D signaling pathway
    100773737 (Hras)
   04071 Sphingolipid signaling pathway
    100773737 (Hras)
   04151 PI3K-Akt signaling pathway
    100773737 (Hras)
   04150 mTOR signaling pathway
    100773737 (Hras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100773737 (Hras)
   04140 Autophagy - animal
    100773737 (Hras)
   04137 Mitophagy - animal
    100773737 (Hras)
  09143 Cell growth and death
   04210 Apoptosis
    100773737 (Hras)
   04218 Cellular senescence
    100773737 (Hras)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100773737 (Hras)
   04540 Gap junction
    100773737 (Hras)
   04550 Signaling pathways regulating pluripotency of stem cells
    100773737 (Hras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100773737 (Hras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100773737 (Hras)
   04650 Natural killer cell mediated cytotoxicity
    100773737 (Hras)
   04660 T cell receptor signaling pathway
    100773737 (Hras)
   04662 B cell receptor signaling pathway
    100773737 (Hras)
   04664 Fc epsilon RI signaling pathway
    100773737 (Hras)
   04062 Chemokine signaling pathway
    100773737 (Hras)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100773737 (Hras)
   04929 GnRH secretion
    100773737 (Hras)
   04912 GnRH signaling pathway
    100773737 (Hras)
   04915 Estrogen signaling pathway
    100773737 (Hras)
   04917 Prolactin signaling pathway
    100773737 (Hras)
   04921 Oxytocin signaling pathway
    100773737 (Hras)
   04926 Relaxin signaling pathway
    100773737 (Hras)
   04935 Growth hormone synthesis, secretion and action
    100773737 (Hras)
   04919 Thyroid hormone signaling pathway
    100773737 (Hras)
   04916 Melanogenesis
    100773737 (Hras)
  09156 Nervous system
   04725 Cholinergic synapse
    100773737 (Hras)
   04726 Serotonergic synapse
    100773737 (Hras)
   04720 Long-term potentiation
    100773737 (Hras)
   04730 Long-term depression
    100773737 (Hras)
   04722 Neurotrophin signaling pathway
    100773737 (Hras)
  09158 Development and regeneration
   04360 Axon guidance
    100773737 (Hras)
  09149 Aging
   04211 Longevity regulating pathway
    100773737 (Hras)
   04213 Longevity regulating pathway - multiple species
    100773737 (Hras)
  09159 Environmental adaptation
   04714 Thermogenesis
    100773737 (Hras)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100773737 (Hras)
   05206 MicroRNAs in cancer
    100773737 (Hras)
   05205 Proteoglycans in cancer
    100773737 (Hras)
   05203 Viral carcinogenesis
    100773737 (Hras)
   05230 Central carbon metabolism in cancer
    100773737 (Hras)
   05231 Choline metabolism in cancer
    100773737 (Hras)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100773737 (Hras)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100773737 (Hras)
   05225 Hepatocellular carcinoma
    100773737 (Hras)
   05226 Gastric cancer
    100773737 (Hras)
   05214 Glioma
    100773737 (Hras)
   05216 Thyroid cancer
    100773737 (Hras)
   05221 Acute myeloid leukemia
    100773737 (Hras)
   05220 Chronic myeloid leukemia
    100773737 (Hras)
   05218 Melanoma
    100773737 (Hras)
   05211 Renal cell carcinoma
    100773737 (Hras)
   05219 Bladder cancer
    100773737 (Hras)
   05215 Prostate cancer
    100773737 (Hras)
   05213 Endometrial cancer
    100773737 (Hras)
   05224 Breast cancer
    100773737 (Hras)
   05223 Non-small cell lung cancer
    100773737 (Hras)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100773737 (Hras)
   05022 Pathways of neurodegeneration - multiple diseases
    100773737 (Hras)
  09165 Substance dependence
   05034 Alcoholism
    100773737 (Hras)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100773737 (Hras)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100773737 (Hras)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773737 (Hras)
   05170 Human immunodeficiency virus 1 infection
    100773737 (Hras)
   05161 Hepatitis B
    100773737 (Hras)
   05160 Hepatitis C
    100773737 (Hras)
   05163 Human cytomegalovirus infection
    100773737 (Hras)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100773737 (Hras)
   05165 Human papillomavirus infection
    100773737 (Hras)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100773737 (Hras)
   01522 Endocrine resistance
    100773737 (Hras)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100773737 (Hras)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100773737 (Hras)
   04031 GTP-binding proteins [BR:cge04031]
    100773737 (Hras)
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100773737 (Hras)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100773737 (Hras)
  Exosomal proteins of colorectal cancer cells
   100773737 (Hras)
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100773737 (Hras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha Gtr1_RagA ATP_bind_1 Septin
Other DBs
NCBI-GeneID: 100773737
NCBI-ProteinID: XP_027264798
UniProt: G3I3F4
LinkDB
Position
3
AA seq 229 aa
MRGPASAGPRPHPAPAPAPGAVTPASGGAGAPGVAASIEAMTEYKLVVVGAGGVGKSALT
IQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC
VFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIP
YIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS
NT seq 690 nt   +upstreamnt  +downstreamnt
atgcgcggcccagccagcgccggtccgcgcccccaccctgccccggccccggccccgggg
gcagtcactccagcaagcggtggggcaggagctcctggagtggcagcctctatagaagcg
atgacagaatacaagctcgtggtggtgggcgctggaggcgtgggaaagagtgccctgacc
atccagctgatccagaaccattttgtggacgagtatgaccccaccatagaggactcctac
cggaaacaggtggtcattgatggggagacatgtctgctggacatcttagacacagcaggt
caagaggagtatagtgccatgagggaccagtacatgcgcacaggggagggcttcctctgt
gtgtttgccatcaacaacaccaagtcctttgaagacatccatcagtacagggagcagatc
aagcgggtgaaagactcagacgatgtgccaatggtgctggtggggaacaaatgtgacctg
gctgctcgaactgttgagtctcggcaggcccaggaccttgcccgcagctatggcatcccc
tacattgaaacatcagccaagacccggcagggtgtggaggatgccttctacacactagta
cgtgagattcggcagcataaactacggaagctgaacccacccgatgagagtggccctggc
tgcatgagctgcaagtgtgtgctatcctga

KEGG   Cricetulus griseus (Chinese hamster): 113837633
Entry
113837633         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113837633
   04012 ErbB signaling pathway
    113837633
   04014 Ras signaling pathway
    113837633
   04015 Rap1 signaling pathway
    113837633
   04370 VEGF signaling pathway
    113837633
   04371 Apelin signaling pathway
    113837633
   04068 FoxO signaling pathway
    113837633
   04072 Phospholipase D signaling pathway
    113837633
   04071 Sphingolipid signaling pathway
    113837633
   04151 PI3K-Akt signaling pathway
    113837633
   04150 mTOR signaling pathway
    113837633
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113837633
   04137 Mitophagy - animal
    113837633
  09143 Cell growth and death
   04210 Apoptosis
    113837633
   04218 Cellular senescence
    113837633
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113837633
   04550 Signaling pathways regulating pluripotency of stem cells
    113837633
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113837633
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113837633
   04650 Natural killer cell mediated cytotoxicity
    113837633
   04660 T cell receptor signaling pathway
    113837633
   04662 B cell receptor signaling pathway
    113837633
   04664 Fc epsilon RI signaling pathway
    113837633
   04062 Chemokine signaling pathway
    113837633
  09152 Endocrine system
   04910 Insulin signaling pathway
    113837633
   04929 GnRH secretion
    113837633
   04912 GnRH signaling pathway
    113837633
   04915 Estrogen signaling pathway
    113837633
   04914 Progesterone-mediated oocyte maturation
    113837633
   04917 Prolactin signaling pathway
    113837633
   04921 Oxytocin signaling pathway
    113837633
   04926 Relaxin signaling pathway
    113837633
   04935 Growth hormone synthesis, secretion and action
    113837633
   04919 Thyroid hormone signaling pathway
    113837633
   04916 Melanogenesis
    113837633
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113837633
  09156 Nervous system
   04725 Cholinergic synapse
    113837633
   04726 Serotonergic synapse
    113837633
   04720 Long-term potentiation
    113837633
   04730 Long-term depression
    113837633
   04722 Neurotrophin signaling pathway
    113837633
  09158 Development and regeneration
   04360 Axon guidance
    113837633
  09149 Aging
   04211 Longevity regulating pathway
    113837633
   04213 Longevity regulating pathway - multiple species
    113837633
  09159 Environmental adaptation
   04714 Thermogenesis
    113837633
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113837633
   05206 MicroRNAs in cancer
    113837633
   05205 Proteoglycans in cancer
    113837633
   05203 Viral carcinogenesis
    113837633
   05230 Central carbon metabolism in cancer
    113837633
   05231 Choline metabolism in cancer
    113837633
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113837633
  09162 Cancer: specific types
   05210 Colorectal cancer
    113837633
   05212 Pancreatic cancer
    113837633
   05225 Hepatocellular carcinoma
    113837633
   05226 Gastric cancer
    113837633
   05214 Glioma
    113837633
   05216 Thyroid cancer
    113837633
   05221 Acute myeloid leukemia
    113837633
   05220 Chronic myeloid leukemia
    113837633
   05218 Melanoma
    113837633
   05211 Renal cell carcinoma
    113837633
   05219 Bladder cancer
    113837633
   05215 Prostate cancer
    113837633
   05213 Endometrial cancer
    113837633
   05224 Breast cancer
    113837633
   05223 Non-small cell lung cancer
    113837633
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113837633
   05022 Pathways of neurodegeneration - multiple diseases
    113837633
  09165 Substance dependence
   05034 Alcoholism
    113837633
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113837633
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113837633
   05170 Human immunodeficiency virus 1 infection
    113837633
   05161 Hepatitis B
    113837633
   05160 Hepatitis C
    113837633
   05163 Human cytomegalovirus infection
    113837633
   05167 Kaposi sarcoma-associated herpesvirus infection
    113837633
   05165 Human papillomavirus infection
    113837633
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113837633
   01522 Endocrine resistance
    113837633
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113837633
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113837633
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113837633
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113837633
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N MeaB TsaE Septin
Other DBs
NCBI-GeneID: 113837633
NCBI-ProteinID: XP_027288331
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGADGVGKTALTIQLIQYHFVDVYDPTIEDSYRKQVEIDGEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVQEIRNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggtgtaggcaagactgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagaaattgatggagaaatatgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggatttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtcaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
caagaaattcgaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113837935
Entry
113837935         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X2
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113837935
   04012 ErbB signaling pathway
    113837935
   04014 Ras signaling pathway
    113837935
   04015 Rap1 signaling pathway
    113837935
   04370 VEGF signaling pathway
    113837935
   04371 Apelin signaling pathway
    113837935
   04068 FoxO signaling pathway
    113837935
   04072 Phospholipase D signaling pathway
    113837935
   04071 Sphingolipid signaling pathway
    113837935
   04151 PI3K-Akt signaling pathway
    113837935
   04150 mTOR signaling pathway
    113837935
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113837935
   04137 Mitophagy - animal
    113837935
  09143 Cell growth and death
   04210 Apoptosis
    113837935
   04218 Cellular senescence
    113837935
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113837935
   04550 Signaling pathways regulating pluripotency of stem cells
    113837935
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113837935
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113837935
   04650 Natural killer cell mediated cytotoxicity
    113837935
   04660 T cell receptor signaling pathway
    113837935
   04662 B cell receptor signaling pathway
    113837935
   04664 Fc epsilon RI signaling pathway
    113837935
   04062 Chemokine signaling pathway
    113837935
  09152 Endocrine system
   04910 Insulin signaling pathway
    113837935
   04929 GnRH secretion
    113837935
   04912 GnRH signaling pathway
    113837935
   04915 Estrogen signaling pathway
    113837935
   04914 Progesterone-mediated oocyte maturation
    113837935
   04917 Prolactin signaling pathway
    113837935
   04921 Oxytocin signaling pathway
    113837935
   04926 Relaxin signaling pathway
    113837935
   04935 Growth hormone synthesis, secretion and action
    113837935
   04919 Thyroid hormone signaling pathway
    113837935
   04916 Melanogenesis
    113837935
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113837935
  09156 Nervous system
   04725 Cholinergic synapse
    113837935
   04726 Serotonergic synapse
    113837935
   04720 Long-term potentiation
    113837935
   04730 Long-term depression
    113837935
   04722 Neurotrophin signaling pathway
    113837935
  09158 Development and regeneration
   04360 Axon guidance
    113837935
  09149 Aging
   04211 Longevity regulating pathway
    113837935
   04213 Longevity regulating pathway - multiple species
    113837935
  09159 Environmental adaptation
   04714 Thermogenesis
    113837935
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113837935
   05206 MicroRNAs in cancer
    113837935
   05205 Proteoglycans in cancer
    113837935
   05203 Viral carcinogenesis
    113837935
   05230 Central carbon metabolism in cancer
    113837935
   05231 Choline metabolism in cancer
    113837935
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113837935
  09162 Cancer: specific types
   05210 Colorectal cancer
    113837935
   05212 Pancreatic cancer
    113837935
   05225 Hepatocellular carcinoma
    113837935
   05226 Gastric cancer
    113837935
   05214 Glioma
    113837935
   05216 Thyroid cancer
    113837935
   05221 Acute myeloid leukemia
    113837935
   05220 Chronic myeloid leukemia
    113837935
   05218 Melanoma
    113837935
   05211 Renal cell carcinoma
    113837935
   05219 Bladder cancer
    113837935
   05215 Prostate cancer
    113837935
   05213 Endometrial cancer
    113837935
   05224 Breast cancer
    113837935
   05223 Non-small cell lung cancer
    113837935
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113837935
   05022 Pathways of neurodegeneration - multiple diseases
    113837935
  09165 Substance dependence
   05034 Alcoholism
    113837935
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113837935
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113837935
   05170 Human immunodeficiency virus 1 infection
    113837935
   05161 Hepatitis B
    113837935
   05160 Hepatitis C
    113837935
   05163 Human cytomegalovirus infection
    113837935
   05167 Kaposi sarcoma-associated herpesvirus infection
    113837935
   05165 Human papillomavirus infection
    113837935
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113837935
   01522 Endocrine resistance
    113837935
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113837935
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113837935
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113837935
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113837935
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin
Other DBs
NCBI-GeneID: 113837935
NCBI-ProteinID: XP_027289554
LinkDB
Position
Unknown
AA seq 160 aa
MSEYKLVVVGADGVGKTALTIQLIQYHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVGDAFYTLV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgagtgaatataaacttgtggtagttggagctgatggcgtaggcaagactgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttggtgatgccttctatacattagtc
tga

KEGG   Cricetulus griseus (Chinese hamster): 113837956
Entry
113837956         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113837956
   04012 ErbB signaling pathway
    113837956
   04014 Ras signaling pathway
    113837956
   04015 Rap1 signaling pathway
    113837956
   04370 VEGF signaling pathway
    113837956
   04371 Apelin signaling pathway
    113837956
   04068 FoxO signaling pathway
    113837956
   04072 Phospholipase D signaling pathway
    113837956
   04071 Sphingolipid signaling pathway
    113837956
   04151 PI3K-Akt signaling pathway
    113837956
   04150 mTOR signaling pathway
    113837956
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113837956
   04137 Mitophagy - animal
    113837956
  09143 Cell growth and death
   04210 Apoptosis
    113837956
   04218 Cellular senescence
    113837956
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113837956
   04550 Signaling pathways regulating pluripotency of stem cells
    113837956
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113837956
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113837956
   04650 Natural killer cell mediated cytotoxicity
    113837956
   04660 T cell receptor signaling pathway
    113837956
   04662 B cell receptor signaling pathway
    113837956
   04664 Fc epsilon RI signaling pathway
    113837956
   04062 Chemokine signaling pathway
    113837956
  09152 Endocrine system
   04910 Insulin signaling pathway
    113837956
   04929 GnRH secretion
    113837956
   04912 GnRH signaling pathway
    113837956
   04915 Estrogen signaling pathway
    113837956
   04914 Progesterone-mediated oocyte maturation
    113837956
   04917 Prolactin signaling pathway
    113837956
   04921 Oxytocin signaling pathway
    113837956
   04926 Relaxin signaling pathway
    113837956
   04935 Growth hormone synthesis, secretion and action
    113837956
   04919 Thyroid hormone signaling pathway
    113837956
   04916 Melanogenesis
    113837956
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113837956
  09156 Nervous system
   04725 Cholinergic synapse
    113837956
   04726 Serotonergic synapse
    113837956
   04720 Long-term potentiation
    113837956
   04730 Long-term depression
    113837956
   04722 Neurotrophin signaling pathway
    113837956
  09158 Development and regeneration
   04360 Axon guidance
    113837956
  09149 Aging
   04211 Longevity regulating pathway
    113837956
   04213 Longevity regulating pathway - multiple species
    113837956
  09159 Environmental adaptation
   04714 Thermogenesis
    113837956
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113837956
   05206 MicroRNAs in cancer
    113837956
   05205 Proteoglycans in cancer
    113837956
   05203 Viral carcinogenesis
    113837956
   05230 Central carbon metabolism in cancer
    113837956
   05231 Choline metabolism in cancer
    113837956
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113837956
  09162 Cancer: specific types
   05210 Colorectal cancer
    113837956
   05212 Pancreatic cancer
    113837956
   05225 Hepatocellular carcinoma
    113837956
   05226 Gastric cancer
    113837956
   05214 Glioma
    113837956
   05216 Thyroid cancer
    113837956
   05221 Acute myeloid leukemia
    113837956
   05220 Chronic myeloid leukemia
    113837956
   05218 Melanoma
    113837956
   05211 Renal cell carcinoma
    113837956
   05219 Bladder cancer
    113837956
   05215 Prostate cancer
    113837956
   05213 Endometrial cancer
    113837956
   05224 Breast cancer
    113837956
   05223 Non-small cell lung cancer
    113837956
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113837956
   05022 Pathways of neurodegeneration - multiple diseases
    113837956
  09165 Substance dependence
   05034 Alcoholism
    113837956
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113837956
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113837956
   05170 Human immunodeficiency virus 1 infection
    113837956
   05161 Hepatitis B
    113837956
   05160 Hepatitis C
    113837956
   05163 Human cytomegalovirus infection
    113837956
   05167 Kaposi sarcoma-associated herpesvirus infection
    113837956
   05165 Human papillomavirus infection
    113837956
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113837956
   01522 Endocrine resistance
    113837956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113837956
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113837956
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113837956
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113837956
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N MeaB Septin
Other DBs
NCBI-GeneID: 113837956
NCBI-ProteinID: XP_027289566
LinkDB
Position
Unknown
AA seq 188 aa
MSEYKLVVVGADGVGKTALTVQLIQYHFVDVYDPTIEDSYRKQVKIDGETCLLDILDTAG
LEEYSAMRDQYMRIGEGFLCVFAMNNTKSFEAIHHFREEIKRVKDSEDVPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVREIQNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagtgaatataaacttgtggttgttggagctgatggcgtaggcaagactgccttgacg
gtacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtaaaaattgatggagaaacctgtctcttggacattctcgacacagcaggt
ctagaggagtacagtgcaatgagggaccagtacatgaggattggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattttagagaagaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacaccaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
cgagaaattcaaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113837960
Entry
113837960         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113837960
   04012 ErbB signaling pathway
    113837960
   04014 Ras signaling pathway
    113837960
   04015 Rap1 signaling pathway
    113837960
   04370 VEGF signaling pathway
    113837960
   04371 Apelin signaling pathway
    113837960
   04068 FoxO signaling pathway
    113837960
   04072 Phospholipase D signaling pathway
    113837960
   04071 Sphingolipid signaling pathway
    113837960
   04151 PI3K-Akt signaling pathway
    113837960
   04150 mTOR signaling pathway
    113837960
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113837960
   04137 Mitophagy - animal
    113837960
  09143 Cell growth and death
   04210 Apoptosis
    113837960
   04218 Cellular senescence
    113837960
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113837960
   04550 Signaling pathways regulating pluripotency of stem cells
    113837960
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113837960
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113837960
   04650 Natural killer cell mediated cytotoxicity
    113837960
   04660 T cell receptor signaling pathway
    113837960
   04662 B cell receptor signaling pathway
    113837960
   04664 Fc epsilon RI signaling pathway
    113837960
   04062 Chemokine signaling pathway
    113837960
  09152 Endocrine system
   04910 Insulin signaling pathway
    113837960
   04929 GnRH secretion
    113837960
   04912 GnRH signaling pathway
    113837960
   04915 Estrogen signaling pathway
    113837960
   04914 Progesterone-mediated oocyte maturation
    113837960
   04917 Prolactin signaling pathway
    113837960
   04921 Oxytocin signaling pathway
    113837960
   04926 Relaxin signaling pathway
    113837960
   04935 Growth hormone synthesis, secretion and action
    113837960
   04919 Thyroid hormone signaling pathway
    113837960
   04916 Melanogenesis
    113837960
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113837960
  09156 Nervous system
   04725 Cholinergic synapse
    113837960
   04726 Serotonergic synapse
    113837960
   04720 Long-term potentiation
    113837960
   04730 Long-term depression
    113837960
   04722 Neurotrophin signaling pathway
    113837960
  09158 Development and regeneration
   04360 Axon guidance
    113837960
  09149 Aging
   04211 Longevity regulating pathway
    113837960
   04213 Longevity regulating pathway - multiple species
    113837960
  09159 Environmental adaptation
   04714 Thermogenesis
    113837960
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113837960
   05206 MicroRNAs in cancer
    113837960
   05205 Proteoglycans in cancer
    113837960
   05203 Viral carcinogenesis
    113837960
   05230 Central carbon metabolism in cancer
    113837960
   05231 Choline metabolism in cancer
    113837960
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113837960
  09162 Cancer: specific types
   05210 Colorectal cancer
    113837960
   05212 Pancreatic cancer
    113837960
   05225 Hepatocellular carcinoma
    113837960
   05226 Gastric cancer
    113837960
   05214 Glioma
    113837960
   05216 Thyroid cancer
    113837960
   05221 Acute myeloid leukemia
    113837960
   05220 Chronic myeloid leukemia
    113837960
   05218 Melanoma
    113837960
   05211 Renal cell carcinoma
    113837960
   05219 Bladder cancer
    113837960
   05215 Prostate cancer
    113837960
   05213 Endometrial cancer
    113837960
   05224 Breast cancer
    113837960
   05223 Non-small cell lung cancer
    113837960
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113837960
   05022 Pathways of neurodegeneration - multiple diseases
    113837960
  09165 Substance dependence
   05034 Alcoholism
    113837960
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113837960
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113837960
   05170 Human immunodeficiency virus 1 infection
    113837960
   05161 Hepatitis B
    113837960
   05160 Hepatitis C
    113837960
   05163 Human cytomegalovirus infection
    113837960
   05167 Kaposi sarcoma-associated herpesvirus infection
    113837960
   05165 Human papillomavirus infection
    113837960
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113837960
   01522 Endocrine resistance
    113837960
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113837960
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113837960
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113837960
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113837960
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU FeoB_N AIG1 Septin RNA_helicase
Other DBs
NCBI-GeneID: 113837960
NCBI-ProteinID: XP_035309742
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDREICHLDILDTAG
LEEYSAMRDQYMKTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQNRLKKISKEEKTPGR
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctat
aggaagcaagtagtaattgatagagaaatctgtcacttggatattctcgacacagcaggt
ctagaggagtacagtgcaatgagggaccagtacatgaagactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagaacagattgaaaaaaatcagcaaagaagaaaagactcctggcagg
gtgaagattaaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838098
Entry
113838098         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838098
   04012 ErbB signaling pathway
    113838098
   04014 Ras signaling pathway
    113838098
   04015 Rap1 signaling pathway
    113838098
   04370 VEGF signaling pathway
    113838098
   04371 Apelin signaling pathway
    113838098
   04068 FoxO signaling pathway
    113838098
   04072 Phospholipase D signaling pathway
    113838098
   04071 Sphingolipid signaling pathway
    113838098
   04151 PI3K-Akt signaling pathway
    113838098
   04150 mTOR signaling pathway
    113838098
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838098
   04137 Mitophagy - animal
    113838098
  09143 Cell growth and death
   04210 Apoptosis
    113838098
   04218 Cellular senescence
    113838098
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838098
   04550 Signaling pathways regulating pluripotency of stem cells
    113838098
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838098
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838098
   04650 Natural killer cell mediated cytotoxicity
    113838098
   04660 T cell receptor signaling pathway
    113838098
   04662 B cell receptor signaling pathway
    113838098
   04664 Fc epsilon RI signaling pathway
    113838098
   04062 Chemokine signaling pathway
    113838098
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838098
   04929 GnRH secretion
    113838098
   04912 GnRH signaling pathway
    113838098
   04915 Estrogen signaling pathway
    113838098
   04914 Progesterone-mediated oocyte maturation
    113838098
   04917 Prolactin signaling pathway
    113838098
   04921 Oxytocin signaling pathway
    113838098
   04926 Relaxin signaling pathway
    113838098
   04935 Growth hormone synthesis, secretion and action
    113838098
   04919 Thyroid hormone signaling pathway
    113838098
   04916 Melanogenesis
    113838098
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838098
  09156 Nervous system
   04725 Cholinergic synapse
    113838098
   04726 Serotonergic synapse
    113838098
   04720 Long-term potentiation
    113838098
   04730 Long-term depression
    113838098
   04722 Neurotrophin signaling pathway
    113838098
  09158 Development and regeneration
   04360 Axon guidance
    113838098
  09149 Aging
   04211 Longevity regulating pathway
    113838098
   04213 Longevity regulating pathway - multiple species
    113838098
  09159 Environmental adaptation
   04714 Thermogenesis
    113838098
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838098
   05206 MicroRNAs in cancer
    113838098
   05205 Proteoglycans in cancer
    113838098
   05203 Viral carcinogenesis
    113838098
   05230 Central carbon metabolism in cancer
    113838098
   05231 Choline metabolism in cancer
    113838098
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838098
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838098
   05212 Pancreatic cancer
    113838098
   05225 Hepatocellular carcinoma
    113838098
   05226 Gastric cancer
    113838098
   05214 Glioma
    113838098
   05216 Thyroid cancer
    113838098
   05221 Acute myeloid leukemia
    113838098
   05220 Chronic myeloid leukemia
    113838098
   05218 Melanoma
    113838098
   05211 Renal cell carcinoma
    113838098
   05219 Bladder cancer
    113838098
   05215 Prostate cancer
    113838098
   05213 Endometrial cancer
    113838098
   05224 Breast cancer
    113838098
   05223 Non-small cell lung cancer
    113838098
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838098
   05022 Pathways of neurodegeneration - multiple diseases
    113838098
  09165 Substance dependence
   05034 Alcoholism
    113838098
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838098
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838098
   05170 Human immunodeficiency virus 1 infection
    113838098
   05161 Hepatitis B
    113838098
   05160 Hepatitis C
    113838098
   05163 Human cytomegalovirus infection
    113838098
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838098
   05165 Human papillomavirus infection
    113838098
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838098
   01522 Endocrine resistance
    113838098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838098
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838098
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838098
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838098
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MeaB FeoB_N G-alpha Septin VirE RNA_helicase AAA_22
Other DBs
NCBI-GeneID: 113838098
NCBI-ProteinID: XP_035309770
LinkDB
Position
Unknown
AA seq 188 aa
MSEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDREICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHFREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVRDIRKHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagtgaatataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatagagaaatctgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataacactaaatcatttgaagctattcaccattttagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
cgagatattcgaaaacataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838146
Entry
113838146         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838146
   04012 ErbB signaling pathway
    113838146
   04014 Ras signaling pathway
    113838146
   04015 Rap1 signaling pathway
    113838146
   04370 VEGF signaling pathway
    113838146
   04371 Apelin signaling pathway
    113838146
   04068 FoxO signaling pathway
    113838146
   04072 Phospholipase D signaling pathway
    113838146
   04071 Sphingolipid signaling pathway
    113838146
   04151 PI3K-Akt signaling pathway
    113838146
   04150 mTOR signaling pathway
    113838146
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838146
   04137 Mitophagy - animal
    113838146
  09143 Cell growth and death
   04210 Apoptosis
    113838146
   04218 Cellular senescence
    113838146
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838146
   04550 Signaling pathways regulating pluripotency of stem cells
    113838146
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838146
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838146
   04650 Natural killer cell mediated cytotoxicity
    113838146
   04660 T cell receptor signaling pathway
    113838146
   04662 B cell receptor signaling pathway
    113838146
   04664 Fc epsilon RI signaling pathway
    113838146
   04062 Chemokine signaling pathway
    113838146
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838146
   04929 GnRH secretion
    113838146
   04912 GnRH signaling pathway
    113838146
   04915 Estrogen signaling pathway
    113838146
   04914 Progesterone-mediated oocyte maturation
    113838146
   04917 Prolactin signaling pathway
    113838146
   04921 Oxytocin signaling pathway
    113838146
   04926 Relaxin signaling pathway
    113838146
   04935 Growth hormone synthesis, secretion and action
    113838146
   04919 Thyroid hormone signaling pathway
    113838146
   04916 Melanogenesis
    113838146
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838146
  09156 Nervous system
   04725 Cholinergic synapse
    113838146
   04726 Serotonergic synapse
    113838146
   04720 Long-term potentiation
    113838146
   04730 Long-term depression
    113838146
   04722 Neurotrophin signaling pathway
    113838146
  09158 Development and regeneration
   04360 Axon guidance
    113838146
  09149 Aging
   04211 Longevity regulating pathway
    113838146
   04213 Longevity regulating pathway - multiple species
    113838146
  09159 Environmental adaptation
   04714 Thermogenesis
    113838146
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838146
   05206 MicroRNAs in cancer
    113838146
   05205 Proteoglycans in cancer
    113838146
   05203 Viral carcinogenesis
    113838146
   05230 Central carbon metabolism in cancer
    113838146
   05231 Choline metabolism in cancer
    113838146
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838146
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838146
   05212 Pancreatic cancer
    113838146
   05225 Hepatocellular carcinoma
    113838146
   05226 Gastric cancer
    113838146
   05214 Glioma
    113838146
   05216 Thyroid cancer
    113838146
   05221 Acute myeloid leukemia
    113838146
   05220 Chronic myeloid leukemia
    113838146
   05218 Melanoma
    113838146
   05211 Renal cell carcinoma
    113838146
   05219 Bladder cancer
    113838146
   05215 Prostate cancer
    113838146
   05213 Endometrial cancer
    113838146
   05224 Breast cancer
    113838146
   05223 Non-small cell lung cancer
    113838146
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838146
   05022 Pathways of neurodegeneration - multiple diseases
    113838146
  09165 Substance dependence
   05034 Alcoholism
    113838146
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838146
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838146
   05170 Human immunodeficiency virus 1 infection
    113838146
   05161 Hepatitis B
    113838146
   05160 Hepatitis C
    113838146
   05163 Human cytomegalovirus infection
    113838146
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838146
   05165 Human papillomavirus infection
    113838146
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838146
   01522 Endocrine resistance
    113838146
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838146
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838146
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838146
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838146
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N MeaB TsaE Septin
Other DBs
NCBI-GeneID: 113838146
NCBI-ProteinID: XP_027289737
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGADGVGKTALTIQLIQYHFVDVYDPTIEDSYRKQVEIDGEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVQEIRNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggtgtaggcaagactgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagaaattgatggagaaatatgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggatttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtcaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
caagaaattcgaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838228
Entry
113838228         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838228
   04012 ErbB signaling pathway
    113838228
   04014 Ras signaling pathway
    113838228
   04015 Rap1 signaling pathway
    113838228
   04370 VEGF signaling pathway
    113838228
   04371 Apelin signaling pathway
    113838228
   04068 FoxO signaling pathway
    113838228
   04072 Phospholipase D signaling pathway
    113838228
   04071 Sphingolipid signaling pathway
    113838228
   04151 PI3K-Akt signaling pathway
    113838228
   04150 mTOR signaling pathway
    113838228
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838228
   04137 Mitophagy - animal
    113838228
  09143 Cell growth and death
   04210 Apoptosis
    113838228
   04218 Cellular senescence
    113838228
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838228
   04550 Signaling pathways regulating pluripotency of stem cells
    113838228
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838228
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838228
   04650 Natural killer cell mediated cytotoxicity
    113838228
   04660 T cell receptor signaling pathway
    113838228
   04662 B cell receptor signaling pathway
    113838228
   04664 Fc epsilon RI signaling pathway
    113838228
   04062 Chemokine signaling pathway
    113838228
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838228
   04929 GnRH secretion
    113838228
   04912 GnRH signaling pathway
    113838228
   04915 Estrogen signaling pathway
    113838228
   04914 Progesterone-mediated oocyte maturation
    113838228
   04917 Prolactin signaling pathway
    113838228
   04921 Oxytocin signaling pathway
    113838228
   04926 Relaxin signaling pathway
    113838228
   04935 Growth hormone synthesis, secretion and action
    113838228
   04919 Thyroid hormone signaling pathway
    113838228
   04916 Melanogenesis
    113838228
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838228
  09156 Nervous system
   04725 Cholinergic synapse
    113838228
   04726 Serotonergic synapse
    113838228
   04720 Long-term potentiation
    113838228
   04730 Long-term depression
    113838228
   04722 Neurotrophin signaling pathway
    113838228
  09158 Development and regeneration
   04360 Axon guidance
    113838228
  09149 Aging
   04211 Longevity regulating pathway
    113838228
   04213 Longevity regulating pathway - multiple species
    113838228
  09159 Environmental adaptation
   04714 Thermogenesis
    113838228
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838228
   05206 MicroRNAs in cancer
    113838228
   05205 Proteoglycans in cancer
    113838228
   05203 Viral carcinogenesis
    113838228
   05230 Central carbon metabolism in cancer
    113838228
   05231 Choline metabolism in cancer
    113838228
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838228
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838228
   05212 Pancreatic cancer
    113838228
   05225 Hepatocellular carcinoma
    113838228
   05226 Gastric cancer
    113838228
   05214 Glioma
    113838228
   05216 Thyroid cancer
    113838228
   05221 Acute myeloid leukemia
    113838228
   05220 Chronic myeloid leukemia
    113838228
   05218 Melanoma
    113838228
   05211 Renal cell carcinoma
    113838228
   05219 Bladder cancer
    113838228
   05215 Prostate cancer
    113838228
   05213 Endometrial cancer
    113838228
   05224 Breast cancer
    113838228
   05223 Non-small cell lung cancer
    113838228
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838228
   05022 Pathways of neurodegeneration - multiple diseases
    113838228
  09165 Substance dependence
   05034 Alcoholism
    113838228
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838228
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838228
   05170 Human immunodeficiency virus 1 infection
    113838228
   05161 Hepatitis B
    113838228
   05160 Hepatitis C
    113838228
   05163 Human cytomegalovirus infection
    113838228
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838228
   05165 Human papillomavirus infection
    113838228
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838228
   01522 Endocrine resistance
    113838228
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838228
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838228
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838228
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838228
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin AAA_28 AAA_33 G-alpha AAA_22 Gtr1_RagA
Other DBs
NCBI-GeneID: 113838228
NCBI-ProteinID: XP_027289839
LinkDB
Position
Unknown
AA seq 187 aa
MTQYKIVVVGADGVGKSALTIQLLQNHFVDVYDPTIEDSYRKQVVIDGETCHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTIDTSQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLLREIGNHKEKMSRDDKKKKKI
SRQCIIM
NT seq 564 nt   +upstreamnt  +downstreamnt
atgactcagtataaaattgtggtagtgggagctgatggcgtaggcaagagtgccttgacg
atacagctacttcagaatcactttgtggatgtgtatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcttagtagggaataaatgtgatttg
ccttctagaaccatagacacaagtcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattgctc
cgagaaattggaaatcataaagaaaagatgagcagagatgataaaaagaagaaaaagatt
tcaagacagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838326
Entry
113838326         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838326
   04012 ErbB signaling pathway
    113838326
   04014 Ras signaling pathway
    113838326
   04015 Rap1 signaling pathway
    113838326
   04370 VEGF signaling pathway
    113838326
   04371 Apelin signaling pathway
    113838326
   04068 FoxO signaling pathway
    113838326
   04072 Phospholipase D signaling pathway
    113838326
   04071 Sphingolipid signaling pathway
    113838326
   04151 PI3K-Akt signaling pathway
    113838326
   04150 mTOR signaling pathway
    113838326
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838326
   04137 Mitophagy - animal
    113838326
  09143 Cell growth and death
   04210 Apoptosis
    113838326
   04218 Cellular senescence
    113838326
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838326
   04550 Signaling pathways regulating pluripotency of stem cells
    113838326
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838326
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838326
   04650 Natural killer cell mediated cytotoxicity
    113838326
   04660 T cell receptor signaling pathway
    113838326
   04662 B cell receptor signaling pathway
    113838326
   04664 Fc epsilon RI signaling pathway
    113838326
   04062 Chemokine signaling pathway
    113838326
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838326
   04929 GnRH secretion
    113838326
   04912 GnRH signaling pathway
    113838326
   04915 Estrogen signaling pathway
    113838326
   04914 Progesterone-mediated oocyte maturation
    113838326
   04917 Prolactin signaling pathway
    113838326
   04921 Oxytocin signaling pathway
    113838326
   04926 Relaxin signaling pathway
    113838326
   04935 Growth hormone synthesis, secretion and action
    113838326
   04919 Thyroid hormone signaling pathway
    113838326
   04916 Melanogenesis
    113838326
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838326
  09156 Nervous system
   04725 Cholinergic synapse
    113838326
   04726 Serotonergic synapse
    113838326
   04720 Long-term potentiation
    113838326
   04730 Long-term depression
    113838326
   04722 Neurotrophin signaling pathway
    113838326
  09158 Development and regeneration
   04360 Axon guidance
    113838326
  09149 Aging
   04211 Longevity regulating pathway
    113838326
   04213 Longevity regulating pathway - multiple species
    113838326
  09159 Environmental adaptation
   04714 Thermogenesis
    113838326
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838326
   05206 MicroRNAs in cancer
    113838326
   05205 Proteoglycans in cancer
    113838326
   05203 Viral carcinogenesis
    113838326
   05230 Central carbon metabolism in cancer
    113838326
   05231 Choline metabolism in cancer
    113838326
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838326
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838326
   05212 Pancreatic cancer
    113838326
   05225 Hepatocellular carcinoma
    113838326
   05226 Gastric cancer
    113838326
   05214 Glioma
    113838326
   05216 Thyroid cancer
    113838326
   05221 Acute myeloid leukemia
    113838326
   05220 Chronic myeloid leukemia
    113838326
   05218 Melanoma
    113838326
   05211 Renal cell carcinoma
    113838326
   05219 Bladder cancer
    113838326
   05215 Prostate cancer
    113838326
   05213 Endometrial cancer
    113838326
   05224 Breast cancer
    113838326
   05223 Non-small cell lung cancer
    113838326
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838326
   05022 Pathways of neurodegeneration - multiple diseases
    113838326
  09165 Substance dependence
   05034 Alcoholism
    113838326
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838326
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838326
   05170 Human immunodeficiency virus 1 infection
    113838326
   05161 Hepatitis B
    113838326
   05160 Hepatitis C
    113838326
   05163 Human cytomegalovirus infection
    113838326
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838326
   05165 Human papillomavirus infection
    113838326
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838326
   01522 Endocrine resistance
    113838326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838326
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838326
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838326
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838326
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase TsaE FeoB_N ATP_bind_1 Septin
Other DBs
NCBI-GeneID: 113838326
NCBI-ProteinID: XP_035309470
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKTALTIQLIQYHFVDVYDPTIEDSYRKQVEIDGEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGIYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGR
VKIKKCTVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggtgtaggcaagactgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacaatagaggactcctac
aggaaacaagtagaaattgatggagaaatatgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaatttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaattagcaaagaagaaaagactcctggccgt
gtgaagattaaaaaatgcactgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838417
Entry
113838417         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838417
   04012 ErbB signaling pathway
    113838417
   04014 Ras signaling pathway
    113838417
   04015 Rap1 signaling pathway
    113838417
   04370 VEGF signaling pathway
    113838417
   04371 Apelin signaling pathway
    113838417
   04068 FoxO signaling pathway
    113838417
   04072 Phospholipase D signaling pathway
    113838417
   04071 Sphingolipid signaling pathway
    113838417
   04151 PI3K-Akt signaling pathway
    113838417
   04150 mTOR signaling pathway
    113838417
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838417
   04137 Mitophagy - animal
    113838417
  09143 Cell growth and death
   04210 Apoptosis
    113838417
   04218 Cellular senescence
    113838417
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838417
   04550 Signaling pathways regulating pluripotency of stem cells
    113838417
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838417
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838417
   04650 Natural killer cell mediated cytotoxicity
    113838417
   04660 T cell receptor signaling pathway
    113838417
   04662 B cell receptor signaling pathway
    113838417
   04664 Fc epsilon RI signaling pathway
    113838417
   04062 Chemokine signaling pathway
    113838417
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838417
   04929 GnRH secretion
    113838417
   04912 GnRH signaling pathway
    113838417
   04915 Estrogen signaling pathway
    113838417
   04914 Progesterone-mediated oocyte maturation
    113838417
   04917 Prolactin signaling pathway
    113838417
   04921 Oxytocin signaling pathway
    113838417
   04926 Relaxin signaling pathway
    113838417
   04935 Growth hormone synthesis, secretion and action
    113838417
   04919 Thyroid hormone signaling pathway
    113838417
   04916 Melanogenesis
    113838417
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838417
  09156 Nervous system
   04725 Cholinergic synapse
    113838417
   04726 Serotonergic synapse
    113838417
   04720 Long-term potentiation
    113838417
   04730 Long-term depression
    113838417
   04722 Neurotrophin signaling pathway
    113838417
  09158 Development and regeneration
   04360 Axon guidance
    113838417
  09149 Aging
   04211 Longevity regulating pathway
    113838417
   04213 Longevity regulating pathway - multiple species
    113838417
  09159 Environmental adaptation
   04714 Thermogenesis
    113838417
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838417
   05206 MicroRNAs in cancer
    113838417
   05205 Proteoglycans in cancer
    113838417
   05203 Viral carcinogenesis
    113838417
   05230 Central carbon metabolism in cancer
    113838417
   05231 Choline metabolism in cancer
    113838417
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838417
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838417
   05212 Pancreatic cancer
    113838417
   05225 Hepatocellular carcinoma
    113838417
   05226 Gastric cancer
    113838417
   05214 Glioma
    113838417
   05216 Thyroid cancer
    113838417
   05221 Acute myeloid leukemia
    113838417
   05220 Chronic myeloid leukemia
    113838417
   05218 Melanoma
    113838417
   05211 Renal cell carcinoma
    113838417
   05219 Bladder cancer
    113838417
   05215 Prostate cancer
    113838417
   05213 Endometrial cancer
    113838417
   05224 Breast cancer
    113838417
   05223 Non-small cell lung cancer
    113838417
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838417
   05022 Pathways of neurodegeneration - multiple diseases
    113838417
  09165 Substance dependence
   05034 Alcoholism
    113838417
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838417
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838417
   05170 Human immunodeficiency virus 1 infection
    113838417
   05161 Hepatitis B
    113838417
   05160 Hepatitis C
    113838417
   05163 Human cytomegalovirus infection
    113838417
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838417
   05165 Human papillomavirus infection
    113838417
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838417
   01522 Endocrine resistance
    113838417
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838417
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838417
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838417
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838417
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha Septin FeoB_N NPR1_interact RNA_helicase
Other DBs
NCBI-GeneID: 113838417
NCBI-ProteinID: XP_035309510
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDGEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDAEDVPMVLVGNKCDL
PSRAVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYKEKMSKDGKKNKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggtgtaggcaagagtgccttgacc
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatggagaaatctgtcacttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagacgctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtataaagaaaagatgagcaaagatggtaaaaagaataaaaagaag
tcaaaaacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838488
Entry
113838488         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838488
   04012 ErbB signaling pathway
    113838488
   04014 Ras signaling pathway
    113838488
   04015 Rap1 signaling pathway
    113838488
   04370 VEGF signaling pathway
    113838488
   04371 Apelin signaling pathway
    113838488
   04068 FoxO signaling pathway
    113838488
   04072 Phospholipase D signaling pathway
    113838488
   04071 Sphingolipid signaling pathway
    113838488
   04151 PI3K-Akt signaling pathway
    113838488
   04150 mTOR signaling pathway
    113838488
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838488
   04137 Mitophagy - animal
    113838488
  09143 Cell growth and death
   04210 Apoptosis
    113838488
   04218 Cellular senescence
    113838488
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838488
   04550 Signaling pathways regulating pluripotency of stem cells
    113838488
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838488
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838488
   04650 Natural killer cell mediated cytotoxicity
    113838488
   04660 T cell receptor signaling pathway
    113838488
   04662 B cell receptor signaling pathway
    113838488
   04664 Fc epsilon RI signaling pathway
    113838488
   04062 Chemokine signaling pathway
    113838488
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838488
   04929 GnRH secretion
    113838488
   04912 GnRH signaling pathway
    113838488
   04915 Estrogen signaling pathway
    113838488
   04914 Progesterone-mediated oocyte maturation
    113838488
   04917 Prolactin signaling pathway
    113838488
   04921 Oxytocin signaling pathway
    113838488
   04926 Relaxin signaling pathway
    113838488
   04935 Growth hormone synthesis, secretion and action
    113838488
   04919 Thyroid hormone signaling pathway
    113838488
   04916 Melanogenesis
    113838488
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838488
  09156 Nervous system
   04725 Cholinergic synapse
    113838488
   04726 Serotonergic synapse
    113838488
   04720 Long-term potentiation
    113838488
   04730 Long-term depression
    113838488
   04722 Neurotrophin signaling pathway
    113838488
  09158 Development and regeneration
   04360 Axon guidance
    113838488
  09149 Aging
   04211 Longevity regulating pathway
    113838488
   04213 Longevity regulating pathway - multiple species
    113838488
  09159 Environmental adaptation
   04714 Thermogenesis
    113838488
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838488
   05206 MicroRNAs in cancer
    113838488
   05205 Proteoglycans in cancer
    113838488
   05203 Viral carcinogenesis
    113838488
   05230 Central carbon metabolism in cancer
    113838488
   05231 Choline metabolism in cancer
    113838488
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838488
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838488
   05212 Pancreatic cancer
    113838488
   05225 Hepatocellular carcinoma
    113838488
   05226 Gastric cancer
    113838488
   05214 Glioma
    113838488
   05216 Thyroid cancer
    113838488
   05221 Acute myeloid leukemia
    113838488
   05220 Chronic myeloid leukemia
    113838488
   05218 Melanoma
    113838488
   05211 Renal cell carcinoma
    113838488
   05219 Bladder cancer
    113838488
   05215 Prostate cancer
    113838488
   05213 Endometrial cancer
    113838488
   05224 Breast cancer
    113838488
   05223 Non-small cell lung cancer
    113838488
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838488
   05022 Pathways of neurodegeneration - multiple diseases
    113838488
  09165 Substance dependence
   05034 Alcoholism
    113838488
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838488
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838488
   05170 Human immunodeficiency virus 1 infection
    113838488
   05161 Hepatitis B
    113838488
   05160 Hepatitis C
    113838488
   05163 Human cytomegalovirus infection
    113838488
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838488
   05165 Human papillomavirus infection
    113838488
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838488
   01522 Endocrine resistance
    113838488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838488
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838488
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838488
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838488
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha Septin FeoB_N VirE Gtr1_RagA RNA_helicase AAA_33 AAA_22
Other DBs
NCBI-GeneID: 113838488
NCBI-ProteinID: XP_035309571
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDKEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDAEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYALVREIRQYRLKNISKEEKTPGR
VKIKKCTVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgataaagaaatctgtcatttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagatgctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatgcattggtg
agagagatcagacagtacagattgaaaaatatcagcaaagaagaaaagactcctggcagg
gtgaagattaaaaaatgcactgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838583
Entry
113838583         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838583
   04012 ErbB signaling pathway
    113838583
   04014 Ras signaling pathway
    113838583
   04015 Rap1 signaling pathway
    113838583
   04370 VEGF signaling pathway
    113838583
   04371 Apelin signaling pathway
    113838583
   04068 FoxO signaling pathway
    113838583
   04072 Phospholipase D signaling pathway
    113838583
   04071 Sphingolipid signaling pathway
    113838583
   04151 PI3K-Akt signaling pathway
    113838583
   04150 mTOR signaling pathway
    113838583
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838583
   04137 Mitophagy - animal
    113838583
  09143 Cell growth and death
   04210 Apoptosis
    113838583
   04218 Cellular senescence
    113838583
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838583
   04550 Signaling pathways regulating pluripotency of stem cells
    113838583
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838583
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838583
   04650 Natural killer cell mediated cytotoxicity
    113838583
   04660 T cell receptor signaling pathway
    113838583
   04662 B cell receptor signaling pathway
    113838583
   04664 Fc epsilon RI signaling pathway
    113838583
   04062 Chemokine signaling pathway
    113838583
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838583
   04929 GnRH secretion
    113838583
   04912 GnRH signaling pathway
    113838583
   04915 Estrogen signaling pathway
    113838583
   04914 Progesterone-mediated oocyte maturation
    113838583
   04917 Prolactin signaling pathway
    113838583
   04921 Oxytocin signaling pathway
    113838583
   04926 Relaxin signaling pathway
    113838583
   04935 Growth hormone synthesis, secretion and action
    113838583
   04919 Thyroid hormone signaling pathway
    113838583
   04916 Melanogenesis
    113838583
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838583
  09156 Nervous system
   04725 Cholinergic synapse
    113838583
   04726 Serotonergic synapse
    113838583
   04720 Long-term potentiation
    113838583
   04730 Long-term depression
    113838583
   04722 Neurotrophin signaling pathway
    113838583
  09158 Development and regeneration
   04360 Axon guidance
    113838583
  09149 Aging
   04211 Longevity regulating pathway
    113838583
   04213 Longevity regulating pathway - multiple species
    113838583
  09159 Environmental adaptation
   04714 Thermogenesis
    113838583
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838583
   05206 MicroRNAs in cancer
    113838583
   05205 Proteoglycans in cancer
    113838583
   05203 Viral carcinogenesis
    113838583
   05230 Central carbon metabolism in cancer
    113838583
   05231 Choline metabolism in cancer
    113838583
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838583
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838583
   05212 Pancreatic cancer
    113838583
   05225 Hepatocellular carcinoma
    113838583
   05226 Gastric cancer
    113838583
   05214 Glioma
    113838583
   05216 Thyroid cancer
    113838583
   05221 Acute myeloid leukemia
    113838583
   05220 Chronic myeloid leukemia
    113838583
   05218 Melanoma
    113838583
   05211 Renal cell carcinoma
    113838583
   05219 Bladder cancer
    113838583
   05215 Prostate cancer
    113838583
   05213 Endometrial cancer
    113838583
   05224 Breast cancer
    113838583
   05223 Non-small cell lung cancer
    113838583
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838583
   05022 Pathways of neurodegeneration - multiple diseases
    113838583
  09165 Substance dependence
   05034 Alcoholism
    113838583
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838583
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838583
   05170 Human immunodeficiency virus 1 infection
    113838583
   05161 Hepatitis B
    113838583
   05160 Hepatitis C
    113838583
   05163 Human cytomegalovirus infection
    113838583
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838583
   05165 Human papillomavirus infection
    113838583
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838583
   01522 Endocrine resistance
    113838583
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838583
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838583
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838583
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838583
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Septin G-alpha PAG DUF728 FeoB_N Hpr_kinase_C AAA_33
Other DBs
NCBI-GeneID: 113838583
NCBI-ProteinID: XP_035309507
LinkDB
Position
Unknown
AA seq 189 aa
MSEYKLMVVGADGVGKSALTIQLIQNHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRAKDSEDMPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQNHKEKMSKDGKKKKK
KSKTKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgaatataaacttatggttgttggagctgatggcgtaggcaagagtgccttgaca
atacagctaattcagaatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagcaaaagactctgaagatatgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaatcaggctcaggacttagcaggaagttatgggattccg
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaag
aagtcaaaaacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838653
Entry
113838653         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X2
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838653
   04012 ErbB signaling pathway
    113838653
   04014 Ras signaling pathway
    113838653
   04015 Rap1 signaling pathway
    113838653
   04370 VEGF signaling pathway
    113838653
   04371 Apelin signaling pathway
    113838653
   04068 FoxO signaling pathway
    113838653
   04072 Phospholipase D signaling pathway
    113838653
   04071 Sphingolipid signaling pathway
    113838653
   04151 PI3K-Akt signaling pathway
    113838653
   04150 mTOR signaling pathway
    113838653
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838653
   04137 Mitophagy - animal
    113838653
  09143 Cell growth and death
   04210 Apoptosis
    113838653
   04218 Cellular senescence
    113838653
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838653
   04550 Signaling pathways regulating pluripotency of stem cells
    113838653
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838653
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838653
   04650 Natural killer cell mediated cytotoxicity
    113838653
   04660 T cell receptor signaling pathway
    113838653
   04662 B cell receptor signaling pathway
    113838653
   04664 Fc epsilon RI signaling pathway
    113838653
   04062 Chemokine signaling pathway
    113838653
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838653
   04929 GnRH secretion
    113838653
   04912 GnRH signaling pathway
    113838653
   04915 Estrogen signaling pathway
    113838653
   04914 Progesterone-mediated oocyte maturation
    113838653
   04917 Prolactin signaling pathway
    113838653
   04921 Oxytocin signaling pathway
    113838653
   04926 Relaxin signaling pathway
    113838653
   04935 Growth hormone synthesis, secretion and action
    113838653
   04919 Thyroid hormone signaling pathway
    113838653
   04916 Melanogenesis
    113838653
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838653
  09156 Nervous system
   04725 Cholinergic synapse
    113838653
   04726 Serotonergic synapse
    113838653
   04720 Long-term potentiation
    113838653
   04730 Long-term depression
    113838653
   04722 Neurotrophin signaling pathway
    113838653
  09158 Development and regeneration
   04360 Axon guidance
    113838653
  09149 Aging
   04211 Longevity regulating pathway
    113838653
   04213 Longevity regulating pathway - multiple species
    113838653
  09159 Environmental adaptation
   04714 Thermogenesis
    113838653
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838653
   05206 MicroRNAs in cancer
    113838653
   05205 Proteoglycans in cancer
    113838653
   05203 Viral carcinogenesis
    113838653
   05230 Central carbon metabolism in cancer
    113838653
   05231 Choline metabolism in cancer
    113838653
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838653
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838653
   05212 Pancreatic cancer
    113838653
   05225 Hepatocellular carcinoma
    113838653
   05226 Gastric cancer
    113838653
   05214 Glioma
    113838653
   05216 Thyroid cancer
    113838653
   05221 Acute myeloid leukemia
    113838653
   05220 Chronic myeloid leukemia
    113838653
   05218 Melanoma
    113838653
   05211 Renal cell carcinoma
    113838653
   05219 Bladder cancer
    113838653
   05215 Prostate cancer
    113838653
   05213 Endometrial cancer
    113838653
   05224 Breast cancer
    113838653
   05223 Non-small cell lung cancer
    113838653
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838653
   05022 Pathways of neurodegeneration - multiple diseases
    113838653
  09165 Substance dependence
   05034 Alcoholism
    113838653
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838653
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838653
   05170 Human immunodeficiency virus 1 infection
    113838653
   05161 Hepatitis B
    113838653
   05160 Hepatitis C
    113838653
   05163 Human cytomegalovirus infection
    113838653
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838653
   05165 Human papillomavirus infection
    113838653
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838653
   01522 Endocrine resistance
    113838653
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838653
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838653
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838653
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838653
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 AAA G-alpha FeoB_N AAA_24 ATPase_2 AAA_22
Other DBs
NCBI-GeneID: 113838653
NCBI-ProteinID: XP_027290035
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGPDGVGKTALTIQLIQYHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFATNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRAVDTNQVQDLAGSYGIPFIETSAKTRQRVEDAFYTLVQEIRNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagtgggacctgatggcgtaggcaagactgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccacgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaatcaggttcaggacttagcaggtagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattagtc
caagaaattcgaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838676
Entry
113838676         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838676
   04012 ErbB signaling pathway
    113838676
   04014 Ras signaling pathway
    113838676
   04015 Rap1 signaling pathway
    113838676
   04370 VEGF signaling pathway
    113838676
   04371 Apelin signaling pathway
    113838676
   04068 FoxO signaling pathway
    113838676
   04072 Phospholipase D signaling pathway
    113838676
   04071 Sphingolipid signaling pathway
    113838676
   04151 PI3K-Akt signaling pathway
    113838676
   04150 mTOR signaling pathway
    113838676
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838676
   04137 Mitophagy - animal
    113838676
  09143 Cell growth and death
   04210 Apoptosis
    113838676
   04218 Cellular senescence
    113838676
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838676
   04550 Signaling pathways regulating pluripotency of stem cells
    113838676
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838676
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838676
   04650 Natural killer cell mediated cytotoxicity
    113838676
   04660 T cell receptor signaling pathway
    113838676
   04662 B cell receptor signaling pathway
    113838676
   04664 Fc epsilon RI signaling pathway
    113838676
   04062 Chemokine signaling pathway
    113838676
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838676
   04929 GnRH secretion
    113838676
   04912 GnRH signaling pathway
    113838676
   04915 Estrogen signaling pathway
    113838676
   04914 Progesterone-mediated oocyte maturation
    113838676
   04917 Prolactin signaling pathway
    113838676
   04921 Oxytocin signaling pathway
    113838676
   04926 Relaxin signaling pathway
    113838676
   04935 Growth hormone synthesis, secretion and action
    113838676
   04919 Thyroid hormone signaling pathway
    113838676
   04916 Melanogenesis
    113838676
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838676
  09156 Nervous system
   04725 Cholinergic synapse
    113838676
   04726 Serotonergic synapse
    113838676
   04720 Long-term potentiation
    113838676
   04730 Long-term depression
    113838676
   04722 Neurotrophin signaling pathway
    113838676
  09158 Development and regeneration
   04360 Axon guidance
    113838676
  09149 Aging
   04211 Longevity regulating pathway
    113838676
   04213 Longevity regulating pathway - multiple species
    113838676
  09159 Environmental adaptation
   04714 Thermogenesis
    113838676
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838676
   05206 MicroRNAs in cancer
    113838676
   05205 Proteoglycans in cancer
    113838676
   05203 Viral carcinogenesis
    113838676
   05230 Central carbon metabolism in cancer
    113838676
   05231 Choline metabolism in cancer
    113838676
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838676
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838676
   05212 Pancreatic cancer
    113838676
   05225 Hepatocellular carcinoma
    113838676
   05226 Gastric cancer
    113838676
   05214 Glioma
    113838676
   05216 Thyroid cancer
    113838676
   05221 Acute myeloid leukemia
    113838676
   05220 Chronic myeloid leukemia
    113838676
   05218 Melanoma
    113838676
   05211 Renal cell carcinoma
    113838676
   05219 Bladder cancer
    113838676
   05215 Prostate cancer
    113838676
   05213 Endometrial cancer
    113838676
   05224 Breast cancer
    113838676
   05223 Non-small cell lung cancer
    113838676
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838676
   05022 Pathways of neurodegeneration - multiple diseases
    113838676
  09165 Substance dependence
   05034 Alcoholism
    113838676
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838676
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838676
   05170 Human immunodeficiency virus 1 infection
    113838676
   05161 Hepatitis B
    113838676
   05160 Hepatitis C
    113838676
   05163 Human cytomegalovirus infection
    113838676
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838676
   05165 Human papillomavirus infection
    113838676
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838676
   01522 Endocrine resistance
    113838676
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838676
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838676
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838676
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838676
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU FeoB_N AIG1 Septin RNA_helicase
Other DBs
NCBI-GeneID: 113838676
NCBI-ProteinID: XP_035309820
LinkDB
Position
Unknown
AA seq 189 aa
MSEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDREICHLDILDTAG
LEEYSAMSDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGR
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttaacg
atacagctaattcagaatctctttgtggatgaatatgatcctacgatagaggactcctac
aggaaacaagtagtaattgatagagaaatctgtcacttggacattctcgacacagcaggt
ctagaggagtacagtgcaatgagcgaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattccg
tttattgaaacttcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagactcctggcagg
gtgaagattaaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838679
Entry
113838679         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838679
   04012 ErbB signaling pathway
    113838679
   04014 Ras signaling pathway
    113838679
   04015 Rap1 signaling pathway
    113838679
   04370 VEGF signaling pathway
    113838679
   04371 Apelin signaling pathway
    113838679
   04068 FoxO signaling pathway
    113838679
   04072 Phospholipase D signaling pathway
    113838679
   04071 Sphingolipid signaling pathway
    113838679
   04151 PI3K-Akt signaling pathway
    113838679
   04150 mTOR signaling pathway
    113838679
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838679
   04137 Mitophagy - animal
    113838679
  09143 Cell growth and death
   04210 Apoptosis
    113838679
   04218 Cellular senescence
    113838679
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838679
   04550 Signaling pathways regulating pluripotency of stem cells
    113838679
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838679
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838679
   04650 Natural killer cell mediated cytotoxicity
    113838679
   04660 T cell receptor signaling pathway
    113838679
   04662 B cell receptor signaling pathway
    113838679
   04664 Fc epsilon RI signaling pathway
    113838679
   04062 Chemokine signaling pathway
    113838679
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838679
   04929 GnRH secretion
    113838679
   04912 GnRH signaling pathway
    113838679
   04915 Estrogen signaling pathway
    113838679
   04914 Progesterone-mediated oocyte maturation
    113838679
   04917 Prolactin signaling pathway
    113838679
   04921 Oxytocin signaling pathway
    113838679
   04926 Relaxin signaling pathway
    113838679
   04935 Growth hormone synthesis, secretion and action
    113838679
   04919 Thyroid hormone signaling pathway
    113838679
   04916 Melanogenesis
    113838679
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838679
  09156 Nervous system
   04725 Cholinergic synapse
    113838679
   04726 Serotonergic synapse
    113838679
   04720 Long-term potentiation
    113838679
   04730 Long-term depression
    113838679
   04722 Neurotrophin signaling pathway
    113838679
  09158 Development and regeneration
   04360 Axon guidance
    113838679
  09149 Aging
   04211 Longevity regulating pathway
    113838679
   04213 Longevity regulating pathway - multiple species
    113838679
  09159 Environmental adaptation
   04714 Thermogenesis
    113838679
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838679
   05206 MicroRNAs in cancer
    113838679
   05205 Proteoglycans in cancer
    113838679
   05203 Viral carcinogenesis
    113838679
   05230 Central carbon metabolism in cancer
    113838679
   05231 Choline metabolism in cancer
    113838679
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838679
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838679
   05212 Pancreatic cancer
    113838679
   05225 Hepatocellular carcinoma
    113838679
   05226 Gastric cancer
    113838679
   05214 Glioma
    113838679
   05216 Thyroid cancer
    113838679
   05221 Acute myeloid leukemia
    113838679
   05220 Chronic myeloid leukemia
    113838679
   05218 Melanoma
    113838679
   05211 Renal cell carcinoma
    113838679
   05219 Bladder cancer
    113838679
   05215 Prostate cancer
    113838679
   05213 Endometrial cancer
    113838679
   05224 Breast cancer
    113838679
   05223 Non-small cell lung cancer
    113838679
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838679
   05022 Pathways of neurodegeneration - multiple diseases
    113838679
  09165 Substance dependence
   05034 Alcoholism
    113838679
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838679
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838679
   05170 Human immunodeficiency virus 1 infection
    113838679
   05161 Hepatitis B
    113838679
   05160 Hepatitis C
    113838679
   05163 Human cytomegalovirus infection
    113838679
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838679
   05165 Human papillomavirus infection
    113838679
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838679
   01522 Endocrine resistance
    113838679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838679
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838679
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838679
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838679
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AIG1 FeoB_N Septin DUF2951
Other DBs
NCBI-GeneID: 113838679
NCBI-ProteinID: XP_035309494
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDREICHLDILDTAG
LEEYSAMRDQYMRTGEGFLCVFATNNTKSFEAIHHYREQIKRVKDAEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRKHKEKVSKDGKKKKKK
SKTNCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatagagaaatctgtcacttggacattctcgacacagcaggt
ctagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccacgaataatactaaatcatttgaagctattcaccattatagagaacaaatc
aaaagagtaaaagacgctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattagtc
cgagaaattcgaaagcataaagaaaaggtgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaattgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838692
Entry
113838692         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838692
   04012 ErbB signaling pathway
    113838692
   04014 Ras signaling pathway
    113838692
   04015 Rap1 signaling pathway
    113838692
   04370 VEGF signaling pathway
    113838692
   04371 Apelin signaling pathway
    113838692
   04068 FoxO signaling pathway
    113838692
   04072 Phospholipase D signaling pathway
    113838692
   04071 Sphingolipid signaling pathway
    113838692
   04151 PI3K-Akt signaling pathway
    113838692
   04150 mTOR signaling pathway
    113838692
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838692
   04137 Mitophagy - animal
    113838692
  09143 Cell growth and death
   04210 Apoptosis
    113838692
   04218 Cellular senescence
    113838692
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838692
   04550 Signaling pathways regulating pluripotency of stem cells
    113838692
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838692
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838692
   04650 Natural killer cell mediated cytotoxicity
    113838692
   04660 T cell receptor signaling pathway
    113838692
   04662 B cell receptor signaling pathway
    113838692
   04664 Fc epsilon RI signaling pathway
    113838692
   04062 Chemokine signaling pathway
    113838692
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838692
   04929 GnRH secretion
    113838692
   04912 GnRH signaling pathway
    113838692
   04915 Estrogen signaling pathway
    113838692
   04914 Progesterone-mediated oocyte maturation
    113838692
   04917 Prolactin signaling pathway
    113838692
   04921 Oxytocin signaling pathway
    113838692
   04926 Relaxin signaling pathway
    113838692
   04935 Growth hormone synthesis, secretion and action
    113838692
   04919 Thyroid hormone signaling pathway
    113838692
   04916 Melanogenesis
    113838692
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838692
  09156 Nervous system
   04725 Cholinergic synapse
    113838692
   04726 Serotonergic synapse
    113838692
   04720 Long-term potentiation
    113838692
   04730 Long-term depression
    113838692
   04722 Neurotrophin signaling pathway
    113838692
  09158 Development and regeneration
   04360 Axon guidance
    113838692
  09149 Aging
   04211 Longevity regulating pathway
    113838692
   04213 Longevity regulating pathway - multiple species
    113838692
  09159 Environmental adaptation
   04714 Thermogenesis
    113838692
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838692
   05206 MicroRNAs in cancer
    113838692
   05205 Proteoglycans in cancer
    113838692
   05203 Viral carcinogenesis
    113838692
   05230 Central carbon metabolism in cancer
    113838692
   05231 Choline metabolism in cancer
    113838692
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838692
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838692
   05212 Pancreatic cancer
    113838692
   05225 Hepatocellular carcinoma
    113838692
   05226 Gastric cancer
    113838692
   05214 Glioma
    113838692
   05216 Thyroid cancer
    113838692
   05221 Acute myeloid leukemia
    113838692
   05220 Chronic myeloid leukemia
    113838692
   05218 Melanoma
    113838692
   05211 Renal cell carcinoma
    113838692
   05219 Bladder cancer
    113838692
   05215 Prostate cancer
    113838692
   05213 Endometrial cancer
    113838692
   05224 Breast cancer
    113838692
   05223 Non-small cell lung cancer
    113838692
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838692
   05022 Pathways of neurodegeneration - multiple diseases
    113838692
  09165 Substance dependence
   05034 Alcoholism
    113838692
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838692
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838692
   05170 Human immunodeficiency virus 1 infection
    113838692
   05161 Hepatitis B
    113838692
   05160 Hepatitis C
    113838692
   05163 Human cytomegalovirus infection
    113838692
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838692
   05165 Human papillomavirus infection
    113838692
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838692
   01522 Endocrine resistance
    113838692
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838692
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838692
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838692
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838692
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha Septin AAA_33 Gtr1_RagA AAA_22 AAA_28
Other DBs
NCBI-GeneID: 113838692
NCBI-ProteinID: XP_027290057
LinkDB
Position
Unknown
AA seq 188 aa
MTQYKIVVVGADGVGKSALTIQLLQNHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTSQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLLREIRNHKEKMSRDDKKKKKN
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactcagtataaaattgtggtagtgggagctgatggcgtaggcaagagtgccttgacg
atacagctacttcagaatcactttgtggatgtatatgatcctacaatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaagtcaggctcaggacttagcaggcagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattgctc
cgagaaattcgaaatcataaagaaaagatgagcagagatgataaaaagaagaaaaagaat
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838722
Entry
113838722         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838722
   04012 ErbB signaling pathway
    113838722
   04014 Ras signaling pathway
    113838722
   04015 Rap1 signaling pathway
    113838722
   04370 VEGF signaling pathway
    113838722
   04371 Apelin signaling pathway
    113838722
   04068 FoxO signaling pathway
    113838722
   04072 Phospholipase D signaling pathway
    113838722
   04071 Sphingolipid signaling pathway
    113838722
   04151 PI3K-Akt signaling pathway
    113838722
   04150 mTOR signaling pathway
    113838722
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838722
   04137 Mitophagy - animal
    113838722
  09143 Cell growth and death
   04210 Apoptosis
    113838722
   04218 Cellular senescence
    113838722
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838722
   04550 Signaling pathways regulating pluripotency of stem cells
    113838722
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838722
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838722
   04650 Natural killer cell mediated cytotoxicity
    113838722
   04660 T cell receptor signaling pathway
    113838722
   04662 B cell receptor signaling pathway
    113838722
   04664 Fc epsilon RI signaling pathway
    113838722
   04062 Chemokine signaling pathway
    113838722
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838722
   04929 GnRH secretion
    113838722
   04912 GnRH signaling pathway
    113838722
   04915 Estrogen signaling pathway
    113838722
   04914 Progesterone-mediated oocyte maturation
    113838722
   04917 Prolactin signaling pathway
    113838722
   04921 Oxytocin signaling pathway
    113838722
   04926 Relaxin signaling pathway
    113838722
   04935 Growth hormone synthesis, secretion and action
    113838722
   04919 Thyroid hormone signaling pathway
    113838722
   04916 Melanogenesis
    113838722
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838722
  09156 Nervous system
   04725 Cholinergic synapse
    113838722
   04726 Serotonergic synapse
    113838722
   04720 Long-term potentiation
    113838722
   04730 Long-term depression
    113838722
   04722 Neurotrophin signaling pathway
    113838722
  09158 Development and regeneration
   04360 Axon guidance
    113838722
  09149 Aging
   04211 Longevity regulating pathway
    113838722
   04213 Longevity regulating pathway - multiple species
    113838722
  09159 Environmental adaptation
   04714 Thermogenesis
    113838722
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838722
   05206 MicroRNAs in cancer
    113838722
   05205 Proteoglycans in cancer
    113838722
   05203 Viral carcinogenesis
    113838722
   05230 Central carbon metabolism in cancer
    113838722
   05231 Choline metabolism in cancer
    113838722
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838722
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838722
   05212 Pancreatic cancer
    113838722
   05225 Hepatocellular carcinoma
    113838722
   05226 Gastric cancer
    113838722
   05214 Glioma
    113838722
   05216 Thyroid cancer
    113838722
   05221 Acute myeloid leukemia
    113838722
   05220 Chronic myeloid leukemia
    113838722
   05218 Melanoma
    113838722
   05211 Renal cell carcinoma
    113838722
   05219 Bladder cancer
    113838722
   05215 Prostate cancer
    113838722
   05213 Endometrial cancer
    113838722
   05224 Breast cancer
    113838722
   05223 Non-small cell lung cancer
    113838722
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838722
   05022 Pathways of neurodegeneration - multiple diseases
    113838722
  09165 Substance dependence
   05034 Alcoholism
    113838722
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838722
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838722
   05170 Human immunodeficiency virus 1 infection
    113838722
   05161 Hepatitis B
    113838722
   05160 Hepatitis C
    113838722
   05163 Human cytomegalovirus infection
    113838722
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838722
   05165 Human papillomavirus infection
    113838722
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838722
   01522 Endocrine resistance
    113838722
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838722
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838722
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838722
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838722
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N MeaB G-alpha Septin AAA_14
Other DBs
NCBI-GeneID: 113838722
NCBI-ProteinID: XP_027290070
LinkDB
Position
Unknown
AA seq 188 aa
MSEYKLVVVGADGVGKTALTVQLIQYHFVDVYDPTIEDSYRKQVKIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHFREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVREIQNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagtgaatataaacttgtggttgttggagctgatggcgtaggcaagactgccttgacg
gtacagctaattcagtatcactttgtggatgtatatgatcctacgatagaggactcctac
aggaaacaagtaaaaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattttagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
cgagaaattcaaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838746
Entry
113838746         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838746
   04012 ErbB signaling pathway
    113838746
   04014 Ras signaling pathway
    113838746
   04015 Rap1 signaling pathway
    113838746
   04370 VEGF signaling pathway
    113838746
   04371 Apelin signaling pathway
    113838746
   04068 FoxO signaling pathway
    113838746
   04072 Phospholipase D signaling pathway
    113838746
   04071 Sphingolipid signaling pathway
    113838746
   04151 PI3K-Akt signaling pathway
    113838746
   04150 mTOR signaling pathway
    113838746
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838746
   04137 Mitophagy - animal
    113838746
  09143 Cell growth and death
   04210 Apoptosis
    113838746
   04218 Cellular senescence
    113838746
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838746
   04550 Signaling pathways regulating pluripotency of stem cells
    113838746
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838746
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838746
   04650 Natural killer cell mediated cytotoxicity
    113838746
   04660 T cell receptor signaling pathway
    113838746
   04662 B cell receptor signaling pathway
    113838746
   04664 Fc epsilon RI signaling pathway
    113838746
   04062 Chemokine signaling pathway
    113838746
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838746
   04929 GnRH secretion
    113838746
   04912 GnRH signaling pathway
    113838746
   04915 Estrogen signaling pathway
    113838746
   04914 Progesterone-mediated oocyte maturation
    113838746
   04917 Prolactin signaling pathway
    113838746
   04921 Oxytocin signaling pathway
    113838746
   04926 Relaxin signaling pathway
    113838746
   04935 Growth hormone synthesis, secretion and action
    113838746
   04919 Thyroid hormone signaling pathway
    113838746
   04916 Melanogenesis
    113838746
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838746
  09156 Nervous system
   04725 Cholinergic synapse
    113838746
   04726 Serotonergic synapse
    113838746
   04720 Long-term potentiation
    113838746
   04730 Long-term depression
    113838746
   04722 Neurotrophin signaling pathway
    113838746
  09158 Development and regeneration
   04360 Axon guidance
    113838746
  09149 Aging
   04211 Longevity regulating pathway
    113838746
   04213 Longevity regulating pathway - multiple species
    113838746
  09159 Environmental adaptation
   04714 Thermogenesis
    113838746
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838746
   05206 MicroRNAs in cancer
    113838746
   05205 Proteoglycans in cancer
    113838746
   05203 Viral carcinogenesis
    113838746
   05230 Central carbon metabolism in cancer
    113838746
   05231 Choline metabolism in cancer
    113838746
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838746
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838746
   05212 Pancreatic cancer
    113838746
   05225 Hepatocellular carcinoma
    113838746
   05226 Gastric cancer
    113838746
   05214 Glioma
    113838746
   05216 Thyroid cancer
    113838746
   05221 Acute myeloid leukemia
    113838746
   05220 Chronic myeloid leukemia
    113838746
   05218 Melanoma
    113838746
   05211 Renal cell carcinoma
    113838746
   05219 Bladder cancer
    113838746
   05215 Prostate cancer
    113838746
   05213 Endometrial cancer
    113838746
   05224 Breast cancer
    113838746
   05223 Non-small cell lung cancer
    113838746
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838746
   05022 Pathways of neurodegeneration - multiple diseases
    113838746
  09165 Substance dependence
   05034 Alcoholism
    113838746
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838746
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838746
   05170 Human immunodeficiency virus 1 infection
    113838746
   05161 Hepatitis B
    113838746
   05160 Hepatitis C
    113838746
   05163 Human cytomegalovirus infection
    113838746
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838746
   05165 Human papillomavirus infection
    113838746
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838746
   01522 Endocrine resistance
    113838746
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838746
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838746
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838746
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838746
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin
Other DBs
NCBI-GeneID: 113838746
NCBI-ProteinID: XP_035309626
LinkDB
Position
Unknown
AA seq 189 aa
MTEHKLVVVGADGVGKSALTIQLIQYHFVDVYDPTIEDSYRKQVKIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNMKSFEAIHHYREQIKRVKDAEDLPMVLVGNKCDL
PSRAVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTSGR
VKNKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagcataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagtatcactttgtggatgtatacgatcctacaatagaggactcctac
aggaaacaagtaaaaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatatgaaatcgtttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagacgctgaggatttgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagacttctggccgt
gtgaagaataaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838796
Entry
113838796         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838796
   04012 ErbB signaling pathway
    113838796
   04014 Ras signaling pathway
    113838796
   04015 Rap1 signaling pathway
    113838796
   04370 VEGF signaling pathway
    113838796
   04371 Apelin signaling pathway
    113838796
   04068 FoxO signaling pathway
    113838796
   04072 Phospholipase D signaling pathway
    113838796
   04071 Sphingolipid signaling pathway
    113838796
   04151 PI3K-Akt signaling pathway
    113838796
   04150 mTOR signaling pathway
    113838796
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838796
   04137 Mitophagy - animal
    113838796
  09143 Cell growth and death
   04210 Apoptosis
    113838796
   04218 Cellular senescence
    113838796
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838796
   04550 Signaling pathways regulating pluripotency of stem cells
    113838796
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838796
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838796
   04650 Natural killer cell mediated cytotoxicity
    113838796
   04660 T cell receptor signaling pathway
    113838796
   04662 B cell receptor signaling pathway
    113838796
   04664 Fc epsilon RI signaling pathway
    113838796
   04062 Chemokine signaling pathway
    113838796
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838796
   04929 GnRH secretion
    113838796
   04912 GnRH signaling pathway
    113838796
   04915 Estrogen signaling pathway
    113838796
   04914 Progesterone-mediated oocyte maturation
    113838796
   04917 Prolactin signaling pathway
    113838796
   04921 Oxytocin signaling pathway
    113838796
   04926 Relaxin signaling pathway
    113838796
   04935 Growth hormone synthesis, secretion and action
    113838796
   04919 Thyroid hormone signaling pathway
    113838796
   04916 Melanogenesis
    113838796
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838796
  09156 Nervous system
   04725 Cholinergic synapse
    113838796
   04726 Serotonergic synapse
    113838796
   04720 Long-term potentiation
    113838796
   04730 Long-term depression
    113838796
   04722 Neurotrophin signaling pathway
    113838796
  09158 Development and regeneration
   04360 Axon guidance
    113838796
  09149 Aging
   04211 Longevity regulating pathway
    113838796
   04213 Longevity regulating pathway - multiple species
    113838796
  09159 Environmental adaptation
   04714 Thermogenesis
    113838796
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838796
   05206 MicroRNAs in cancer
    113838796
   05205 Proteoglycans in cancer
    113838796
   05203 Viral carcinogenesis
    113838796
   05230 Central carbon metabolism in cancer
    113838796
   05231 Choline metabolism in cancer
    113838796
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838796
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838796
   05212 Pancreatic cancer
    113838796
   05225 Hepatocellular carcinoma
    113838796
   05226 Gastric cancer
    113838796
   05214 Glioma
    113838796
   05216 Thyroid cancer
    113838796
   05221 Acute myeloid leukemia
    113838796
   05220 Chronic myeloid leukemia
    113838796
   05218 Melanoma
    113838796
   05211 Renal cell carcinoma
    113838796
   05219 Bladder cancer
    113838796
   05215 Prostate cancer
    113838796
   05213 Endometrial cancer
    113838796
   05224 Breast cancer
    113838796
   05223 Non-small cell lung cancer
    113838796
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838796
   05022 Pathways of neurodegeneration - multiple diseases
    113838796
  09165 Substance dependence
   05034 Alcoholism
    113838796
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838796
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838796
   05170 Human immunodeficiency virus 1 infection
    113838796
   05161 Hepatitis B
    113838796
   05160 Hepatitis C
    113838796
   05163 Human cytomegalovirus infection
    113838796
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838796
   05165 Human papillomavirus infection
    113838796
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838796
   01522 Endocrine resistance
    113838796
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838796
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838796
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838796
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838796
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase GTP_EFTU FeoB_N AIG1 Septin G-alpha RNA_helicase
Other DBs
NCBI-GeneID: 113838796
NCBI-ProteinID: XP_035309466
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDREICHLDILDTAG
LEEYSAMSDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDAEDVPMVLVGNKCDL
PSRAVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYALVREIRQYRLKKISKEEKTPGR
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatagagaaatctgtcacttggacattctcgacacagcaggt
ctagaggagtacagtgcaatgagcgaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagacgctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatgcattggtg
agagagatccgacagtacagattgaaaaaaatcagcaaagaagaaaagactcctggccgt
gtgaagattaaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838818
Entry
113838818         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838818
   04012 ErbB signaling pathway
    113838818
   04014 Ras signaling pathway
    113838818
   04015 Rap1 signaling pathway
    113838818
   04370 VEGF signaling pathway
    113838818
   04371 Apelin signaling pathway
    113838818
   04068 FoxO signaling pathway
    113838818
   04072 Phospholipase D signaling pathway
    113838818
   04071 Sphingolipid signaling pathway
    113838818
   04151 PI3K-Akt signaling pathway
    113838818
   04150 mTOR signaling pathway
    113838818
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838818
   04137 Mitophagy - animal
    113838818
  09143 Cell growth and death
   04210 Apoptosis
    113838818
   04218 Cellular senescence
    113838818
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838818
   04550 Signaling pathways regulating pluripotency of stem cells
    113838818
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838818
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838818
   04650 Natural killer cell mediated cytotoxicity
    113838818
   04660 T cell receptor signaling pathway
    113838818
   04662 B cell receptor signaling pathway
    113838818
   04664 Fc epsilon RI signaling pathway
    113838818
   04062 Chemokine signaling pathway
    113838818
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838818
   04929 GnRH secretion
    113838818
   04912 GnRH signaling pathway
    113838818
   04915 Estrogen signaling pathway
    113838818
   04914 Progesterone-mediated oocyte maturation
    113838818
   04917 Prolactin signaling pathway
    113838818
   04921 Oxytocin signaling pathway
    113838818
   04926 Relaxin signaling pathway
    113838818
   04935 Growth hormone synthesis, secretion and action
    113838818
   04919 Thyroid hormone signaling pathway
    113838818
   04916 Melanogenesis
    113838818
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838818
  09156 Nervous system
   04725 Cholinergic synapse
    113838818
   04726 Serotonergic synapse
    113838818
   04720 Long-term potentiation
    113838818
   04730 Long-term depression
    113838818
   04722 Neurotrophin signaling pathway
    113838818
  09158 Development and regeneration
   04360 Axon guidance
    113838818
  09149 Aging
   04211 Longevity regulating pathway
    113838818
   04213 Longevity regulating pathway - multiple species
    113838818
  09159 Environmental adaptation
   04714 Thermogenesis
    113838818
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838818
   05206 MicroRNAs in cancer
    113838818
   05205 Proteoglycans in cancer
    113838818
   05203 Viral carcinogenesis
    113838818
   05230 Central carbon metabolism in cancer
    113838818
   05231 Choline metabolism in cancer
    113838818
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838818
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838818
   05212 Pancreatic cancer
    113838818
   05225 Hepatocellular carcinoma
    113838818
   05226 Gastric cancer
    113838818
   05214 Glioma
    113838818
   05216 Thyroid cancer
    113838818
   05221 Acute myeloid leukemia
    113838818
   05220 Chronic myeloid leukemia
    113838818
   05218 Melanoma
    113838818
   05211 Renal cell carcinoma
    113838818
   05219 Bladder cancer
    113838818
   05215 Prostate cancer
    113838818
   05213 Endometrial cancer
    113838818
   05224 Breast cancer
    113838818
   05223 Non-small cell lung cancer
    113838818
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838818
   05022 Pathways of neurodegeneration - multiple diseases
    113838818
  09165 Substance dependence
   05034 Alcoholism
    113838818
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838818
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838818
   05170 Human immunodeficiency virus 1 infection
    113838818
   05161 Hepatitis B
    113838818
   05160 Hepatitis C
    113838818
   05163 Human cytomegalovirus infection
    113838818
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838818
   05165 Human papillomavirus infection
    113838818
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838818
   01522 Endocrine resistance
    113838818
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838818
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838818
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838818
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838818
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin G-alpha Gtr1_RagA AAA_33
Other DBs
NCBI-GeneID: 113838818
NCBI-ProteinID: XP_027290137
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLLQNHFVDVYDPTIEDSYRKQVIIDGETCHLDILDTAG
QEEYSVMRDQYMRTGDGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLEKISKEGKTPGM
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctacttcagaatcactttgtggatgtatacgatcctacaatagaggactcctac
aggaaacaagtaataattgatggagaaacctgtcacttggacattctcgacacagcaggt
caagaggagtacagtgtaatgagggaccagtacatgagaactggggatggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagggtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacaccaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattggaaaaaatcagcaaagaaggaaagactcctggcatg
gtgaagattaaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838871
Entry
113838871         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838871
   04012 ErbB signaling pathway
    113838871
   04014 Ras signaling pathway
    113838871
   04015 Rap1 signaling pathway
    113838871
   04370 VEGF signaling pathway
    113838871
   04371 Apelin signaling pathway
    113838871
   04068 FoxO signaling pathway
    113838871
   04072 Phospholipase D signaling pathway
    113838871
   04071 Sphingolipid signaling pathway
    113838871
   04151 PI3K-Akt signaling pathway
    113838871
   04150 mTOR signaling pathway
    113838871
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838871
   04137 Mitophagy - animal
    113838871
  09143 Cell growth and death
   04210 Apoptosis
    113838871
   04218 Cellular senescence
    113838871
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838871
   04550 Signaling pathways regulating pluripotency of stem cells
    113838871
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838871
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838871
   04650 Natural killer cell mediated cytotoxicity
    113838871
   04660 T cell receptor signaling pathway
    113838871
   04662 B cell receptor signaling pathway
    113838871
   04664 Fc epsilon RI signaling pathway
    113838871
   04062 Chemokine signaling pathway
    113838871
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838871
   04929 GnRH secretion
    113838871
   04912 GnRH signaling pathway
    113838871
   04915 Estrogen signaling pathway
    113838871
   04914 Progesterone-mediated oocyte maturation
    113838871
   04917 Prolactin signaling pathway
    113838871
   04921 Oxytocin signaling pathway
    113838871
   04926 Relaxin signaling pathway
    113838871
   04935 Growth hormone synthesis, secretion and action
    113838871
   04919 Thyroid hormone signaling pathway
    113838871
   04916 Melanogenesis
    113838871
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838871
  09156 Nervous system
   04725 Cholinergic synapse
    113838871
   04726 Serotonergic synapse
    113838871
   04720 Long-term potentiation
    113838871
   04730 Long-term depression
    113838871
   04722 Neurotrophin signaling pathway
    113838871
  09158 Development and regeneration
   04360 Axon guidance
    113838871
  09149 Aging
   04211 Longevity regulating pathway
    113838871
   04213 Longevity regulating pathway - multiple species
    113838871
  09159 Environmental adaptation
   04714 Thermogenesis
    113838871
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838871
   05206 MicroRNAs in cancer
    113838871
   05205 Proteoglycans in cancer
    113838871
   05203 Viral carcinogenesis
    113838871
   05230 Central carbon metabolism in cancer
    113838871
   05231 Choline metabolism in cancer
    113838871
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838871
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838871
   05212 Pancreatic cancer
    113838871
   05225 Hepatocellular carcinoma
    113838871
   05226 Gastric cancer
    113838871
   05214 Glioma
    113838871
   05216 Thyroid cancer
    113838871
   05221 Acute myeloid leukemia
    113838871
   05220 Chronic myeloid leukemia
    113838871
   05218 Melanoma
    113838871
   05211 Renal cell carcinoma
    113838871
   05219 Bladder cancer
    113838871
   05215 Prostate cancer
    113838871
   05213 Endometrial cancer
    113838871
   05224 Breast cancer
    113838871
   05223 Non-small cell lung cancer
    113838871
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838871
   05022 Pathways of neurodegeneration - multiple diseases
    113838871
  09165 Substance dependence
   05034 Alcoholism
    113838871
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838871
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838871
   05170 Human immunodeficiency virus 1 infection
    113838871
   05161 Hepatitis B
    113838871
   05160 Hepatitis C
    113838871
   05163 Human cytomegalovirus infection
    113838871
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838871
   05165 Human papillomavirus infection
    113838871
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838871
   01522 Endocrine resistance
    113838871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838871
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838871
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838871
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838871
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Septin Gtr1_RagA FeoB_N VirE RNA_helicase AAA_33 AAA_22
Other DBs
NCBI-GeneID: 113838871
NCBI-ProteinID: XP_035309475
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIEKEICHLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKRISREEKTPGR
VKIKKCTVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgagaaagaaatctgtcatttggacattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaagaatcagcagagaagaaaagactcctggcagg
gtgaagattaaaaaatgcactgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838872
Entry
113838872         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838872
   04012 ErbB signaling pathway
    113838872
   04014 Ras signaling pathway
    113838872
   04015 Rap1 signaling pathway
    113838872
   04370 VEGF signaling pathway
    113838872
   04371 Apelin signaling pathway
    113838872
   04068 FoxO signaling pathway
    113838872
   04072 Phospholipase D signaling pathway
    113838872
   04071 Sphingolipid signaling pathway
    113838872
   04151 PI3K-Akt signaling pathway
    113838872
   04150 mTOR signaling pathway
    113838872
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838872
   04137 Mitophagy - animal
    113838872
  09143 Cell growth and death
   04210 Apoptosis
    113838872
   04218 Cellular senescence
    113838872
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838872
   04550 Signaling pathways regulating pluripotency of stem cells
    113838872
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838872
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838872
   04650 Natural killer cell mediated cytotoxicity
    113838872
   04660 T cell receptor signaling pathway
    113838872
   04662 B cell receptor signaling pathway
    113838872
   04664 Fc epsilon RI signaling pathway
    113838872
   04062 Chemokine signaling pathway
    113838872
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838872
   04929 GnRH secretion
    113838872
   04912 GnRH signaling pathway
    113838872
   04915 Estrogen signaling pathway
    113838872
   04914 Progesterone-mediated oocyte maturation
    113838872
   04917 Prolactin signaling pathway
    113838872
   04921 Oxytocin signaling pathway
    113838872
   04926 Relaxin signaling pathway
    113838872
   04935 Growth hormone synthesis, secretion and action
    113838872
   04919 Thyroid hormone signaling pathway
    113838872
   04916 Melanogenesis
    113838872
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838872
  09156 Nervous system
   04725 Cholinergic synapse
    113838872
   04726 Serotonergic synapse
    113838872
   04720 Long-term potentiation
    113838872
   04730 Long-term depression
    113838872
   04722 Neurotrophin signaling pathway
    113838872
  09158 Development and regeneration
   04360 Axon guidance
    113838872
  09149 Aging
   04211 Longevity regulating pathway
    113838872
   04213 Longevity regulating pathway - multiple species
    113838872
  09159 Environmental adaptation
   04714 Thermogenesis
    113838872
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838872
   05206 MicroRNAs in cancer
    113838872
   05205 Proteoglycans in cancer
    113838872
   05203 Viral carcinogenesis
    113838872
   05230 Central carbon metabolism in cancer
    113838872
   05231 Choline metabolism in cancer
    113838872
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838872
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838872
   05212 Pancreatic cancer
    113838872
   05225 Hepatocellular carcinoma
    113838872
   05226 Gastric cancer
    113838872
   05214 Glioma
    113838872
   05216 Thyroid cancer
    113838872
   05221 Acute myeloid leukemia
    113838872
   05220 Chronic myeloid leukemia
    113838872
   05218 Melanoma
    113838872
   05211 Renal cell carcinoma
    113838872
   05219 Bladder cancer
    113838872
   05215 Prostate cancer
    113838872
   05213 Endometrial cancer
    113838872
   05224 Breast cancer
    113838872
   05223 Non-small cell lung cancer
    113838872
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838872
   05022 Pathways of neurodegeneration - multiple diseases
    113838872
  09165 Substance dependence
   05034 Alcoholism
    113838872
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838872
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838872
   05170 Human immunodeficiency virus 1 infection
    113838872
   05161 Hepatitis B
    113838872
   05160 Hepatitis C
    113838872
   05163 Human cytomegalovirus infection
    113838872
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838872
   05165 Human papillomavirus infection
    113838872
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838872
   01522 Endocrine resistance
    113838872
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838872
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838872
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838872
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838872
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 Septin FeoB_N G-alpha AAA_33
Other DBs
NCBI-GeneID: 113838872
NCBI-ProteinID: XP_035309655
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGADGVGKSALTIQLLQNHFVDVYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSVMRDQYMRTGEGFLCVFAINNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIQQYRLEKISKDGKTPGR
VKIKKCTVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggtgtaggcaagagtgccttgacg
atacagctacttcagaatcactttgtggatgtatacgatcctacaatagaggactcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggacattctcgacacagcaggt
caagaggagtacagtgtaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagggtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacaccaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccaacagtacagattggaaaaaatcagcaaagacggaaagactcctggcagg
gtgaagattaaaaaatgtactgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838876
Entry
113838876         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838876
   04012 ErbB signaling pathway
    113838876
   04014 Ras signaling pathway
    113838876
   04015 Rap1 signaling pathway
    113838876
   04370 VEGF signaling pathway
    113838876
   04371 Apelin signaling pathway
    113838876
   04068 FoxO signaling pathway
    113838876
   04072 Phospholipase D signaling pathway
    113838876
   04071 Sphingolipid signaling pathway
    113838876
   04151 PI3K-Akt signaling pathway
    113838876
   04150 mTOR signaling pathway
    113838876
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838876
   04137 Mitophagy - animal
    113838876
  09143 Cell growth and death
   04210 Apoptosis
    113838876
   04218 Cellular senescence
    113838876
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838876
   04550 Signaling pathways regulating pluripotency of stem cells
    113838876
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838876
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838876
   04650 Natural killer cell mediated cytotoxicity
    113838876
   04660 T cell receptor signaling pathway
    113838876
   04662 B cell receptor signaling pathway
    113838876
   04664 Fc epsilon RI signaling pathway
    113838876
   04062 Chemokine signaling pathway
    113838876
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838876
   04929 GnRH secretion
    113838876
   04912 GnRH signaling pathway
    113838876
   04915 Estrogen signaling pathway
    113838876
   04914 Progesterone-mediated oocyte maturation
    113838876
   04917 Prolactin signaling pathway
    113838876
   04921 Oxytocin signaling pathway
    113838876
   04926 Relaxin signaling pathway
    113838876
   04935 Growth hormone synthesis, secretion and action
    113838876
   04919 Thyroid hormone signaling pathway
    113838876
   04916 Melanogenesis
    113838876
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838876
  09156 Nervous system
   04725 Cholinergic synapse
    113838876
   04726 Serotonergic synapse
    113838876
   04720 Long-term potentiation
    113838876
   04730 Long-term depression
    113838876
   04722 Neurotrophin signaling pathway
    113838876
  09158 Development and regeneration
   04360 Axon guidance
    113838876
  09149 Aging
   04211 Longevity regulating pathway
    113838876
   04213 Longevity regulating pathway - multiple species
    113838876
  09159 Environmental adaptation
   04714 Thermogenesis
    113838876
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838876
   05206 MicroRNAs in cancer
    113838876
   05205 Proteoglycans in cancer
    113838876
   05203 Viral carcinogenesis
    113838876
   05230 Central carbon metabolism in cancer
    113838876
   05231 Choline metabolism in cancer
    113838876
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838876
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838876
   05212 Pancreatic cancer
    113838876
   05225 Hepatocellular carcinoma
    113838876
   05226 Gastric cancer
    113838876
   05214 Glioma
    113838876
   05216 Thyroid cancer
    113838876
   05221 Acute myeloid leukemia
    113838876
   05220 Chronic myeloid leukemia
    113838876
   05218 Melanoma
    113838876
   05211 Renal cell carcinoma
    113838876
   05219 Bladder cancer
    113838876
   05215 Prostate cancer
    113838876
   05213 Endometrial cancer
    113838876
   05224 Breast cancer
    113838876
   05223 Non-small cell lung cancer
    113838876
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838876
   05022 Pathways of neurodegeneration - multiple diseases
    113838876
  09165 Substance dependence
   05034 Alcoholism
    113838876
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838876
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838876
   05170 Human immunodeficiency virus 1 infection
    113838876
   05161 Hepatitis B
    113838876
   05160 Hepatitis C
    113838876
   05163 Human cytomegalovirus infection
    113838876
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838876
   05165 Human papillomavirus infection
    113838876
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838876
   01522 Endocrine resistance
    113838876
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838876
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838876
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838876
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838876
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 MeaB FeoB_N Septin VirE RNA_helicase AAA_33
Other DBs
NCBI-GeneID: 113838876
NCBI-ProteinID: XP_027290180
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGADGVGKSALTIQLIQNLFVDEYDPTIEDSYRKQVVIDKEICHLDILDKAG
QEEYSAMRDQYMRTGEGFLCVFAMNNTKSFEAIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLAGSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKVSKDGKKKKKK
SKTNCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagaatctctttgtggatgaatatgatcccacaatagaggactcctac
aggaaacaagtagtaattgataaagaaatctgtcacttggacattctcgacaaagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataatactaaatcatttgaagctattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagttgggaataaatgtgatttg
ccctctagaacagtagacacaaaacaggctcaggacttagcaggcagttatgggattcca
tttattgaaacctcagcaaagacaagacagggtgttgatgatgccttctatacattagtc
cgagaaattcgaaagcataaagaaaaggtgagcaaagatggtaaaaagaagaaaaagaag
tcaaagacaaattgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838892
Entry
113838892         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838892
   04012 ErbB signaling pathway
    113838892
   04014 Ras signaling pathway
    113838892
   04015 Rap1 signaling pathway
    113838892
   04370 VEGF signaling pathway
    113838892
   04371 Apelin signaling pathway
    113838892
   04068 FoxO signaling pathway
    113838892
   04072 Phospholipase D signaling pathway
    113838892
   04071 Sphingolipid signaling pathway
    113838892
   04151 PI3K-Akt signaling pathway
    113838892
   04150 mTOR signaling pathway
    113838892
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838892
   04137 Mitophagy - animal
    113838892
  09143 Cell growth and death
   04210 Apoptosis
    113838892
   04218 Cellular senescence
    113838892
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838892
   04550 Signaling pathways regulating pluripotency of stem cells
    113838892
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838892
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838892
   04650 Natural killer cell mediated cytotoxicity
    113838892
   04660 T cell receptor signaling pathway
    113838892
   04662 B cell receptor signaling pathway
    113838892
   04664 Fc epsilon RI signaling pathway
    113838892
   04062 Chemokine signaling pathway
    113838892
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838892
   04929 GnRH secretion
    113838892
   04912 GnRH signaling pathway
    113838892
   04915 Estrogen signaling pathway
    113838892
   04914 Progesterone-mediated oocyte maturation
    113838892
   04917 Prolactin signaling pathway
    113838892
   04921 Oxytocin signaling pathway
    113838892
   04926 Relaxin signaling pathway
    113838892
   04935 Growth hormone synthesis, secretion and action
    113838892
   04919 Thyroid hormone signaling pathway
    113838892
   04916 Melanogenesis
    113838892
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838892
  09156 Nervous system
   04725 Cholinergic synapse
    113838892
   04726 Serotonergic synapse
    113838892
   04720 Long-term potentiation
    113838892
   04730 Long-term depression
    113838892
   04722 Neurotrophin signaling pathway
    113838892
  09158 Development and regeneration
   04360 Axon guidance
    113838892
  09149 Aging
   04211 Longevity regulating pathway
    113838892
   04213 Longevity regulating pathway - multiple species
    113838892
  09159 Environmental adaptation
   04714 Thermogenesis
    113838892
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838892
   05206 MicroRNAs in cancer
    113838892
   05205 Proteoglycans in cancer
    113838892
   05203 Viral carcinogenesis
    113838892
   05230 Central carbon metabolism in cancer
    113838892
   05231 Choline metabolism in cancer
    113838892
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838892
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838892
   05212 Pancreatic cancer
    113838892
   05225 Hepatocellular carcinoma
    113838892
   05226 Gastric cancer
    113838892
   05214 Glioma
    113838892
   05216 Thyroid cancer
    113838892
   05221 Acute myeloid leukemia
    113838892
   05220 Chronic myeloid leukemia
    113838892
   05218 Melanoma
    113838892
   05211 Renal cell carcinoma
    113838892
   05219 Bladder cancer
    113838892
   05215 Prostate cancer
    113838892
   05213 Endometrial cancer
    113838892
   05224 Breast cancer
    113838892
   05223 Non-small cell lung cancer
    113838892
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838892
   05022 Pathways of neurodegeneration - multiple diseases
    113838892
  09165 Substance dependence
   05034 Alcoholism
    113838892
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838892
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838892
   05170 Human immunodeficiency virus 1 infection
    113838892
   05161 Hepatitis B
    113838892
   05160 Hepatitis C
    113838892
   05163 Human cytomegalovirus infection
    113838892
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838892
   05165 Human papillomavirus infection
    113838892
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838892
   01522 Endocrine resistance
    113838892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838892
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838892
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838892
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838892
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N PAG Septin MeaB NPR1_interact
Other DBs
NCBI-GeneID: 113838892
NCBI-ProteinID: XP_035309499
LinkDB
Position
Unknown
AA seq 188 aa
MSEYKLVVVGADGVGKSALTIQLIQYHFVDVYDPTIEDSYKKQVVIDGETCHLDILDTAG
QEDYSAMRDQYMRTGEGFLCVFAMNNTKSFETIHHFREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTNQAQDLAGSYGIPFIETSAKTKQRVEDAFYTLVREIRNHKEKMSKDGKKKKKK
SKTKCIIM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgagtgagtataaacttgtggtagttggagctgatggcgtaggcaagagtgccttgacg
atacagctaattcagtatcactttgtggatgtatatgatcctacaatagaggactcctac
aagaaacaagtagtaattgatggagaaacctgtcacttggacattctcgacacagcaggc
caagaggactacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccatgaataacactaaatcatttgaaactattcaccattttagagaacaaatc
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagaacagtagacaccaatcaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaaaacagagagtggaggatgctttttatacattagtc
cgagaaattcgaaatcataaagaaaagatgagcaaagatggtaaaaagaagaaaaagaaa
tcaaagacaaagtgtataattatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838898
Entry
113838898         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838898
   04012 ErbB signaling pathway
    113838898
   04014 Ras signaling pathway
    113838898
   04015 Rap1 signaling pathway
    113838898
   04370 VEGF signaling pathway
    113838898
   04371 Apelin signaling pathway
    113838898
   04068 FoxO signaling pathway
    113838898
   04072 Phospholipase D signaling pathway
    113838898
   04071 Sphingolipid signaling pathway
    113838898
   04151 PI3K-Akt signaling pathway
    113838898
   04150 mTOR signaling pathway
    113838898
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838898
   04137 Mitophagy - animal
    113838898
  09143 Cell growth and death
   04210 Apoptosis
    113838898
   04218 Cellular senescence
    113838898
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838898
   04550 Signaling pathways regulating pluripotency of stem cells
    113838898
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838898
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838898
   04650 Natural killer cell mediated cytotoxicity
    113838898
   04660 T cell receptor signaling pathway
    113838898
   04662 B cell receptor signaling pathway
    113838898
   04664 Fc epsilon RI signaling pathway
    113838898
   04062 Chemokine signaling pathway
    113838898
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838898
   04929 GnRH secretion
    113838898
   04912 GnRH signaling pathway
    113838898
   04915 Estrogen signaling pathway
    113838898
   04914 Progesterone-mediated oocyte maturation
    113838898
   04917 Prolactin signaling pathway
    113838898
   04921 Oxytocin signaling pathway
    113838898
   04926 Relaxin signaling pathway
    113838898
   04935 Growth hormone synthesis, secretion and action
    113838898
   04919 Thyroid hormone signaling pathway
    113838898
   04916 Melanogenesis
    113838898
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838898
  09156 Nervous system
   04725 Cholinergic synapse
    113838898
   04726 Serotonergic synapse
    113838898
   04720 Long-term potentiation
    113838898
   04730 Long-term depression
    113838898
   04722 Neurotrophin signaling pathway
    113838898
  09158 Development and regeneration
   04360 Axon guidance
    113838898
  09149 Aging
   04211 Longevity regulating pathway
    113838898
   04213 Longevity regulating pathway - multiple species
    113838898
  09159 Environmental adaptation
   04714 Thermogenesis
    113838898
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838898
   05206 MicroRNAs in cancer
    113838898
   05205 Proteoglycans in cancer
    113838898
   05203 Viral carcinogenesis
    113838898
   05230 Central carbon metabolism in cancer
    113838898
   05231 Choline metabolism in cancer
    113838898
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838898
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838898
   05212 Pancreatic cancer
    113838898
   05225 Hepatocellular carcinoma
    113838898
   05226 Gastric cancer
    113838898
   05214 Glioma
    113838898
   05216 Thyroid cancer
    113838898
   05221 Acute myeloid leukemia
    113838898
   05220 Chronic myeloid leukemia
    113838898
   05218 Melanoma
    113838898
   05211 Renal cell carcinoma
    113838898
   05219 Bladder cancer
    113838898
   05215 Prostate cancer
    113838898
   05213 Endometrial cancer
    113838898
   05224 Breast cancer
    113838898
   05223 Non-small cell lung cancer
    113838898
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113838898
   05022 Pathways of neurodegeneration - multiple diseases
    113838898
  09165 Substance dependence
   05034 Alcoholism
    113838898
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113838898
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113838898
   05170 Human immunodeficiency virus 1 infection
    113838898
   05161 Hepatitis B
    113838898
   05160 Hepatitis C
    113838898
   05163 Human cytomegalovirus infection
    113838898
   05167 Kaposi sarcoma-associated herpesvirus infection
    113838898
   05165 Human papillomavirus infection
    113838898
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113838898
   01522 Endocrine resistance
    113838898
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    113838898
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:cge04031]
    113838898
Membrane trafficking [BR:cge04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    113838898
GTP-binding proteins [BR:cge04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    113838898
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1
Other DBs
NCBI-GeneID: 113838898
NCBI-ProteinID: XP_035309444
LinkDB
Position
Unknown
AA seq 189 aa
MTVYKLVVFGADGVGKSALKIQLIQNLFVDVYDPTIEDSYRKQVVIDGEICVLHILDTAG
QEEYSAMRDQYMRTGEGFLGVCAMNNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRAVDTKQAQDLAGSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKVIKEEKTPGR
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgtgtataaacttgtggtatttggagctgatggtgtaggcaagagtgccttgaag
atacagctaattcagaatctctttgtggatgtatatgatcctacaatagaggactcctac
aggaaacaagtagtaattgatggagaaatctgtgtcttgcacattctcgacacagcaggt
caagaagagtacagtgcaatgagggaccagtacatgaggactggggaaggctttcttggt
gtatgtgccatgaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagtaaaagactctgaagatgtgcctatggtcctagtagggaataaatgtgatttg
ccttctagagcagtagacacaaaacaggctcaggacttagcaggaagttatgggattcca
tttattgaaacctcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacagtacagattgaaaaaagtcatcaaagaagaaaagactcctggccgt
gtgaagattaaaaaatgcattgtaatgtaa

KEGG   Cricetulus griseus (Chinese hamster): 113838914
Entry
113838914         CDS       T02813                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge04218  Cellular senescence
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04714  Thermogenesis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge04960  Aldosterone-regulated sodium reabsorption
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113838914
   04012 ErbB signaling pathway
    113838914
   04014 Ras signaling pathway
    113838914
   04015 Rap1 signaling pathway
    113838914
   04370 VEGF signaling pathway
    113838914
   04371 Apelin signaling pathway
    113838914
   04068 FoxO signaling pathway
    113838914
   04072 Phospholipase D signaling pathway
    113838914
   04071 Sphingolipid signaling pathway
    113838914
   04151 PI3K-Akt signaling pathway
    113838914
   04150 mTOR signaling pathway
    113838914
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113838914
   04137 Mitophagy - animal
    113838914
  09143 Cell growth and death
   04210 Apoptosis
    113838914
   04218 Cellular senescence
    113838914
  09144 Cellular community - eukaryotes
   04540 Gap junction
    113838914
   04550 Signaling pathways regulating pluripotency of stem cells
    113838914
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113838914
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    113838914
   04650 Natural killer cell mediated cytotoxicity
    113838914
   04660 T cell receptor signaling pathway
    113838914
   04662 B cell receptor signaling pathway
    113838914
   04664 Fc epsilon RI signaling pathway
    113838914
   04062 Chemokine signaling pathway
    113838914
  09152 Endocrine system
   04910 Insulin signaling pathway
    113838914
   04929 GnRH secretion
    113838914
   04912 GnRH signaling pathway
    113838914
   04915 Estrogen signaling pathway
    113838914
   04914 Progesterone-mediated oocyte maturation
    113838914
   04917 Prolactin signaling pathway
    113838914
   04921 Oxytocin signaling pathway
    113838914
   04926 Relaxin signaling pathway
    113838914
   04935 Growth hormone synthesis, secretion and action
    113838914
   04919 Thyroid hormone signaling pathway
    113838914
   04916 Melanogenesis
    113838914
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    113838914
  09156 Nervous system
   04725 Cholinergic synapse
    113838914
   04726 Serotonergic synapse
    113838914
   04720 Long-term potentiation
    113838914
   04730 Long-term depression
    113838914
   04722 Neurotrophin signaling pathway
    113838914
  09158 Development and regeneration
   04360 Axon guidance
    113838914
  09149 Aging
   04211 Longevity regulating pathway
    113838914
   04213 Longevity regulating pathway - multiple species
    113838914
  09159 Environmental adaptation
   04714 Thermogenesis
    113838914
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113838914
   05206 MicroRNAs in cancer
    113838914
   05205 Proteoglycans in cancer
    113838914
   05203 Viral carcinogenesis
    113838914
   05230 Central carbon metabolism in cancer
    113838914
   05231 Choline metabolism in cancer
    113838914
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113838914
  09162 Cancer: specific types
   05210 Colorectal cancer
    113838914
   05212 Pancreatic cancer
    113838914
   05225 Hepatocellular carcinoma
    113838914
   05226 Gastric cancer
    113838914
   05214 Glioma
    113838914
   05216 Thyroid cancer
    113838914
   05221 Acute myeloid leukemia
    113838914
   05220 Chronic myeloid leukemia
    113838914
   05218 Melanoma
    113838914
   05211 Renal cell carcinoma
  &nbs