KEGG   Cricetulus griseus (Chinese hamster): 100758099
Entry
100758099         CDS       T02813                                 

Gene name
Polk
Definition
(RefSeq) DNA polymerase kappa isoform X3
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge03460  Fanconi anemia pathway
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    100758099 (Polk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100758099 (Polk)
   05202 Transcriptional misregulation in cancer
    100758099 (Polk)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100758099 (Polk)
   05212 Pancreatic cancer
    100758099 (Polk)
   05225 Hepatocellular carcinoma
    100758099 (Polk)
   05226 Gastric cancer
    100758099 (Polk)
   05214 Glioma
    100758099 (Polk)
   05216 Thyroid cancer
    100758099 (Polk)
   05220 Chronic myeloid leukemia
    100758099 (Polk)
   05217 Basal cell carcinoma
    100758099 (Polk)
   05218 Melanoma
    100758099 (Polk)
   05213 Endometrial cancer
    100758099 (Polk)
   05224 Breast cancer
    100758099 (Polk)
   05222 Small cell lung cancer
    100758099 (Polk)
   05223 Non-small cell lung cancer
    100758099 (Polk)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100758099 (Polk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cge03400]
    100758099 (Polk)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     100758099 (Polk)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    100758099 (Polk)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 100758099
NCBI-ProteinID: XP_027257484
LinkDB
Position
2
AA seq 856 aa
MDNTKEKNNCKDDLLLRMGLNDNKAGMEGLDKEKINKIIMDATKGSRFYGNELKKEKQVN
QRIESMMQQKAQITSQQLRKAQLQVDRLAMDLERNRNLNNTIVHVDMDAFYAAVEMRDNP
ELKDKPIAVGSMSMLSTSNYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYRAVSKEV
KEILAEYDPNFMAMSLDEAYLNITQHLEERQNWPEDKRRYFNKMGNSIKIDSDKPGEEAN
RLSEDERSISPLLFEDSPPDLQPQGNPFQLNSEEQNSPQIFQNSVVFGTSAEEVVKEIRF
RIEQKTMLTASAGIAPNTMLAKVCSDKNKPNGQYQILPSRKVVMDFIKDLPIRKVSGIGK
VTEKMLMALGIVTCTELYQQRALLSLLFSETSWHYFLHIALGLGSTDLERDGERKSMSVE
RTFSEISNTEEQYSLCQELCTELAHDLQKEGLKGRTVTIKLKNVNFEVKTRASTVPSTLS
TAEEIFAIAKELLKTEVNVASPHPLRLRLMGVRMSTFSNKDAKKHQQMGIIGFLQTEQHA
LSSPGCTAERTDKTEFVKPLEISHKKSFFDKKRSERISNHQDTPRCEVVDQQALQASQPF
QALKKMSESLETLENSRNCQTFMCPVCFRDQEGVSLEAFNEHVDACLDGPSTSENSKMPP
SSYASSAVAGQKEDVHHSIPLCEQRDCEDGEVTSADGVDLEETEDNSLKAASMDTSGANH
SKEEHSDTPNQSCPISLANEAEAVRILSEQESIRPCTDEIVTGQALVCPVCNLEQKTSDL
TLFNVHVDICLNKGIIQELRNNEVNSVGQHKESSRNTGRLQKAAGRTKRRRQRTKWSTSK
KTKPRSPRHTLDMFFK
NT seq 2571 nt   +upstreamnt  +downstreamnt
atggataacacaaaggaaaagaataattgcaaagacgatcttctgcttaggatgggacta
aatgataataaagcaggaatggaaggactagataaagagaaaattaacaaaattataatg
gatgccacaaaggggtccagattttatggaaatgagctcaagaaggaaaagcaagtcaac
caacggattgaaagtatgatgcaacaaaaagctcaaattaccagccagcaactgaggaaa
gcacagttacaggttgacagattggcgatggacttagaacggaaccggaatttgaacaat
accatagttcatgtggacatggatgctttctatgcagctgtagaaatgagagacaatccg
gaactgaaggataaacccattgctgtgggatcaatgagtatgttgtctacttcaaattac
catgcaaggaggtttggtgtccgtgcagccatgccaggatttattgctaagagactctgc
ccacaacttattatagtgcccccaaactttgacaaatatagagctgtgagtaaggaggtt
aaggaaattcttgctgaatatgatcccaattttatggccatgagtctggatgaagcctac
ttgaatataacgcagcacttagaggaaaggcaaaattggcctgaggacaaaagaagatat
ttcaacaaaatgggaaattctataaaaattgattcagataaaccgggtgaggaagctaac
agactgagtgaagatgaacgatccatctccccactgctttttgaagatagccctcctgat
ttgcaaccacaaggaaatcctttccagctgaactctgaagaacaaaacagtcctcaaata
ttccaaaattcggttgtttttggaacatcagctgaggaagtggtaaaggaaattcgcttc
agaattgaacaaaaaacaatgctgacagccagtgcaggtattgcccccaatacaatgtta
gcaaaagtgtgcagtgataagaataagccaaacggacaataccaaattctccccagcaga
aaagtggtgatggacttcatcaaggacttgcctattagaaaggtttctggaataggcaaa
gttacagagaaaatgttaatggctcttggaattgttacttgcacagaactctaccagcag
agagcattgctttctctacttttctccgaaacatcgtggcattatttccttcacatcgcc
ctcggtctaggttcaacagacctggaaagggatggagaaaggaaaagtatgagtgttgaa
aggacattcagtgaaataagtaacacagaagaacagtacagcttatgccaggagctatgc
actgaacttgctcatgatctccagaaggaaggactgaaggggagaactgttactattaag
ctgaagaatgtgaattttgaagtgaaaactcgtgcgtctacagtcccgtccactctttct
actgcagaagaaatatttgccattgctaaggaactgctgaagacagaagtgaacgtggct
tctccacaccccctgaggttaaggttgatgggtgttcggatgtctactttttccaacaaa
gatgccaagaagcaccaacaaatgggcatcattggcttcttacaaactgaacagcatgct
ttgtcatctcctgggtgtactgcagaaagaaccgacaaaactgagtttgtaaagccttta
gaaatatctcataagaagagtttctttgataaaaagcgatcagaaaggatctcaaaccat
caagacacacccagatgtgaagttgtggatcagcaagctttacaggcctcacagccattc
caagctttaaagaagatgagtgagagtttggaaacattagagaattcacgtaactgtcag
acattcatgtgtccagtttgctttagggatcaggaaggtgtcagtctggaagcctttaac
gaacatgtagatgcatgtcttgatggaccatccaccagtgagaactcgaaaatgccccct
tcctcatatgcttcctcagcagttgctggccagaaggaagatgtgcaccattctatccca
ctatgtgagcaacgggattgtgaagatggagaggtcacgtcagcagatggtgtagatctg
gaggagactgaagacaactcattgaaagcagcaagtatggacacttcaggagctaatcac
agcaaagaggaacattctgatactccaaaccagtcttgtcctatttcactggcaaatgaa
gctgaagctgtcagaatattaagtgagcaagaatccatccggccctgtacagatgagata
gtaacaggacaagctctagtttgtcctgtttgtaacctagaacagaagacttctgacctt
accctcttcaatgtgcatgtggatatttgcttaaataaaggcattatccaagaactgagg
aataatgaagttaattcagttggccaacacaaagaaagctccagaaatactggcagactt
cagaaggctgcaggaaggacaaaaaggcggagacagaggacaaagtggtctacatcaaag
aaaacaaaaccccgaagtcccagacacacccttgatatgttttttaaatga

DBGET integrated database retrieval system