KEGG   Cricetulus griseus (Chinese hamster): 100758283
Entry
100758283         CDS       T02813                                 

Gene name
Runx1
Definition
(RefSeq) runt-related transcription factor 1 isoform X5
  KO
K08367  runt-related transcription factor 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04530  Tight junction
cge04659  Th17 cell differentiation
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100758283 (Runx1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100758283 (Runx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100758283 (Runx1)
   05202 Transcriptional misregulation in cancer
    100758283 (Runx1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100758283 (Runx1)
   05220 Chronic myeloid leukemia
    100758283 (Runx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100758283 (Runx1)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    100758283 (Runx1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 100758283
NCBI-ProteinID: XP_027271423
LinkDB
Position
4
AA seq 464 aa
MASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRS
GDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVM
AGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAI
KITVDGPREPRRHRQKLDETKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLN
HSTAFNPQPQSQMQDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTSLS
AELSSRLSTAPDLTAFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSAS
RYHTYLPPPYPGSSQAQAGPFQTSSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNA
STGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcttcagacagcatttttgagtcatttccttcatacccacagtgcttcatgagagat
gccagcacgagccgccgcttcacgccgccttccaccgcgctgagccccggcaagatgagc
gaggcgctaccgctgggcgccccggacggcggcgccgccctggccagcaagctgaggagc
ggcgaccgcagcatggtggaagtactggctgaccacccgggagagctggtgcgcaccgac
agccccaacttcctctgctccgtgctccccactcactggcgctgcaacaagaccctgccc
atcgctttcaaggtggtagcgctgggggacgttcctgatggcactttggtcaccgtgatg
gcaggcaacgatgaaaactattcggcagagctgagaaatgctacagcagccatgaagaac
caagtggcaagattcaacgacctcaggtttgtcggtcggagtggtagaggcaagagtttc
actctgaccatcaccgtctttactaaccccccacaagtcgccacctaccatagagccatc
aagatcacagtggacggaccgagagaaccccgaagacatcggcagaaactagatgagacc
aagccggggagtttgtccttttccgagcggctcagtgaactggagcagctgcggcgcacg
gccatgagggtcagcccgcaccacccagcccccacgcccaaccctcgggcctccttgaac
cactccactgcctttaaccctcagcctcagagtcagatgcaggatgccaggcagatccag
ccgtccccaccgtggtcctatgatcagtcttaccagtacctggggtccatcacctcctct
tccgtgcacccagcaacacccatttcaccaggacgtgccagcgggatgacaagcctctct
gcagagctttccagtcgactttcaacagccccggacctgaccgccttcggtgacccgcgc
cagttccccacgctgccctccatctccgacccgcgcatgcactaccccggcgccttcacc
tactcgccgccggtcacgtcgggcatcggcatcggcatgtcagccatgagctcggcctct
cgctaccacacctacctgccgccgccctacccaggctcctcgcaggcacaggccgggccc
ttccagaccagctcgccctcctaccacctgtactacggcgcgtctgccggctcctaccag
ttctccatggtgggcggcgagcgatcgccgccgcgcatcctgccgccctgcaccaacgcg
tccacgggcgccgcgctgctcaaccccagcctccccagccagagcgacgtggtggagacc
gagggcagccacagcaactcgcccaccaacatgccacccgcgcgcctggaggaggcggtg
tggcggccctactga

KEGG   Cricetulus griseus (Chinese hamster): 100768628
Entry
100768628         CDS       T02813                                 

Gene name
Mecom
Definition
(RefSeq) histone-lysine N-methyltransferase MECOM isoform X1
  KO
K04462  [histone H3]-lysine9 N-methyltransferase (ecotropic virus integration site 1 protein) [EC:2.1.1.367]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00310  Lysine degradation
cge01100  Metabolic pathways
cge04010  MAPK signaling pathway
cge05200  Pathways in cancer
cge05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100768628 (Mecom)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100768628 (Mecom)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100768628 (Mecom)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100768628 (Mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100768628 (Mecom)
   03036 Chromosome and associated proteins [BR:cge03036]
    100768628 (Mecom)
Enzymes [BR:cge01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.367  [histone H3]-lysine9 N-methyltransferase
     100768628 (Mecom)
Transcription factors [BR:cge03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    100768628 (Mecom)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100768628 (Mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_11 zf-met zf-BED zf-C2H2_8 Zn-ribbon_8 Sigma54_activat PyrI_C
Other DBs
NCBI-GeneID: 100768628
NCBI-ProteinID: XP_035307034
LinkDB
Position
1
AA seq 1043 aa
MKSEDDPHEPMAPDIHEERQHRCEDCDQLFESKAELADHQKFPCSTPHSAFSMVEEDLQQ
NLESESDLREIHGSQDCKECDRVFPDLQSLEKHMLSHTEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHKH
IHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFCE
GKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGTNRHPAGLTFPTAPGFS
FSFPGLFPSGLYHRPPLIPASPPVKGLSSTEQSNKCQSPLLTHPQILPATQDILKALSKH
PPVGDNKPVELLPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSDLESDLESD
KEKCKENGKMFKDKVSPLQNLASINNKKEYSNHSVFSASVEEQTAVSGAVNDSIKAIASI
AEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPLKMEPQSPS
EVKKLQKGSSESPFDLTTKRKDEKPLTSVPSKPPATPATSQDQPLDLSMGSRSRAGGTKL
AEPRKNHVFGEKKGSNMEARSTSDGSLQHARPTPFFMDPIYRVEKRKLTDPLEALKEKYL
RPSPGFLFHPQMSAIENMAEKLESFSALKPEASELLQSVPSMFSFRAPPNTLPENLLRKG
KERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNKEKP
FKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDAYFTEIRN
FIGNSNHGSQSPRNMDERMNGSHFKDDKALVTSQSSDLLDDEEVEDEVLLDEEDEDNDIP
GKSGKELGTTNLDEEIPEDDYEEAGTLEMSCKTSPVRYKEEDYKSGLSALDHIRHFTDSL
KMRGMEENQYTDAELSSFSSSSLVPEELKQPLHRKSKSQAYAMMLSLSDKDPIHPTSHSS
SNVWHSMARAAAESSAIQSISHV
NT seq 3132 nt   +upstreamnt  +downstreamnt
atgaagagtgaagacgatccccatgagcccatggcgcctgacatccatgaagaacggcag
caccgctgcgaggactgtgaccagctcttcgaatccaaggctgaactagcagatcaccag
aagttcccatgtagcacacctcactcagcattctccatggtggaagaggacttacaacaa
aaccttgagagtgagagtgacctccgagagatccatggcagccaggactgtaaggaatgt
gacagagttttccccgatctgcaaagcttggagaagcacatgttgtcacatacggaggag
agggaatacaagtgtgatcagtgtcccaaggcatttaactggaagtccaatttaattcgc
caccagatgtcacatgacagtggaaagcactatgagtgtgaaaactgtgccaaggttttc
acggaccctagcaaccttcagcgacacattcggtctcaacatgtcggtgcccgggcacat
gcttgcccggagtgcggtaaaacatttgccacttcgtcaggcctcaaacaacacaagcac
atccacagcagtgtgaagccctttatctgtgaggtctgccataaatcctatactcagttt
tcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgcaaa
gactgtggacaaatgttcagcactacgtcttccttaaataaacacaggaggttttgtgag
ggcaagaaccattttgcggcaggtggattttttggccaaggcatttcacttcctggaacc
ccagctatggataaaacgtccatggttaatatgagtcatgccaacccgggcctggctgac
tattttggcaccaataggcatcctgctggtcttacctttccaacagctcctggattttcc
tttagctttcctggtctgtttccttcaggcttgtaccacaggcctcctctgatacctgct
agtcctcctgttaaaggactatcaagtactgaacagtcaaacaaatgtcaaagtcccctc
ttgacacatcctcagatactgccagccacacaggatattttgaaggcactatctaaacac
ccacctgtaggggacaataagccagtggaactgctgcccgagaggtcctctgaagagagg
ccccttgagaaaatcagtgaccagtcagagagtagtgaccttgatgatgtcagtacacca
agtggcagtgacctggagacaacctcgggctctgatctggaaagtgaccttgaaagtgat
aaagagaaatgtaaagaaaatggtaaaatgttcaaagacaaagtaagccctctgcagaat
ctggcttcaataaataataagaaagaatacagcaatcattccgttttctcagcatctgta
gaggagcaaactgcggtgtcaggagctgtgaatgattctataaaggctattgcgtctatt
gctgaaaaatactttggttccacaggactggtggggctgcaagacaaaaaagtcggagcg
ttaccttacccttccatgtttcccctcccattttttccagcattctctcaatcaatgtac
ccatttcctgatagagacttgaggtcgttacctttgaaaatggaaccccaatcaccaagt
gaagtaaagaaactgcagaagggaagctctgagtccccttttgacctcaccactaagcga
aaggatgagaagcctttgacttcagtcccctcgaagcctccagcaacacctgccacaagc
caagaccagcccctggatctaagtatgggcagtaggagtagagcaggtgggacaaagctg
gctgagcctcggaaaaaccatgtatttggggaaaagaaaggaagcaacatggaagcaaga
tcaacttcagatggctccttgcagcatgcgagacctactcccttcttcatggaccccatt
tatagagtagagaaaagaaagctcaccgacccacttgaagctttgaaagaaaaatacttg
agaccttctccaggcttcttatttcacccacaaatgtcagctattgagaacatggcagaa
aagctagagagcttcagcgccctgaagcctgaggccagtgagctccttcagtccgtgccc
tcgatgttcagcttcagagcacctcctaataccctgcctgagaacctgctgcggaagggg
aaagaacgctacacctgcagatactgtggcaagattttcccaaggtctgcgaacctgacc
cgccacttgagaacccacacaggggagcagccgtacagatgcaaatactgtgatagatca
ttcagcatttcctccaatctgcagcgacatgtccgcaacatccacaacaaggagaaacca
tttaagtgtcacttatgtgatagatgttttggtcaacaaaccaatcttgacagacaccta
aagaaacatgagaatggaaacatgtctggtacagcaacatcttcacctcattcagaacta
gaaagcacaggtgcaatcctggatgacaaagaagatgcttacttcacagagatccggaat
ttcattggaaatagcaaccatggtagtcagtctcctcggaacatggatgagaggatgaat
ggtagtcacttcaaggatgacaaggctttggtaaccagccagagttctgatttactggat
gatgaagaagtagaagatgaagtgctgttggatgaggaggatgaagacaatgacattcct
ggaaaatctggaaaggagctggggacaactaatttagatgaagaaatcccagaggatgac
tatgaggaagcaggcaccctggagatgagttgtaagacatccccggtgaggtataaagag
gaagactataaatctggcctttctgctctagatcacataaggcacttcacagacagcctc
aaaatgaggggaatggaggagaatcaatacactgacgctgagctgtcttcctttagttct
tcttctcttgtgccagaggagcttaaacagccgttacacagaaagtccaagtcacaggca
tatgctatgatgttgtcactgtcagacaaggatccaattcatcccacctcccacagttcc
tccaacgtgtggcacagcatggcaagggctgcagcagaatccagtgccatccagtccata
agccatgtatga

DBGET integrated database retrieval system