KEGG   Cricetulus griseus (Chinese hamster): 100758298
Entry
100758298         CDS       T02813                                 

Gene name
Csnk1a1
Definition
(RefSeq) casein kinase I isoform X6
  KO
K08957  casein kinase 1, alpha [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100758298 (Csnk1a1)
   04340 Hedgehog signaling pathway
    100758298 (Csnk1a1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100758298 (Csnk1a1)
   05226 Gastric cancer
    100758298 (Csnk1a1)
   05224 Breast cancer
    100758298 (Csnk1a1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100758298 (Csnk1a1)
   05022 Pathways of neurodegeneration - multiple diseases
    100758298 (Csnk1a1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100758298 (Csnk1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100758298 (Csnk1a1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100758298 (Csnk1a1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   100758298 (Csnk1a1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Pox_ser-thr_kin ABC1
Other DBs
NCBI-GeneID: 100758298
NCBI-ProteinID: XP_027258586
LinkDB
Position
2
AA seq 374 aa
MASSSGSKAEFIVGGKYKLVRKIGSGSFGDIYLAINITNGEEVAVKLESQKARHPQLLYE
SKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRFTMKTVLMLADQM
ISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSPSQDPSFSGLNQ
LFLIDFGLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLGYVLM
YFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAMYLNYCRGLRFEEAP
DYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKS
NMKGIKDEKLDPLS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atggcgagcagcagtggctccaaggccgaatttatcgtcggggggaaatacaaactggtg
cggaagatcggatctggctccttcggggacatttatctggcgatcaacatcaccaatggc
gaggaagtggcagtgaagctagaatcccagaaggccaggcatccccagttgctgtacgag
agcaaactgtataagattcttcaaggtggggttggcatccctcacatacggtggtatgga
caagaaaaagactataatgtgctagtcatggatcttctggggcccagccttgaagatctc
ttcaatttctgttcaagaaggttcactatgaagaccgtacttatgttagctgaccagatg
atcagtagaattgaatatgtgcatacaaagaattttatacacagagacataaaaccagat
aacttcctaatgggtattgggcgtcactgtaataagtgtttagaatctccagtggggaag
aggaaaagaagcatgactgttagtccttctcaggacccatctttctcaggattaaaccag
ttattccttattgattttggtttggccaaaaagtacagagacaacaggacaaggcaacac
ataccatacagagaagataaaaacctcactggcactgcccggtatgctagcatcaatgca
catcttggtattgagcagagtcgccgagacgacatggaatctttaggatatgttttgatg
tattttaatagaaccagtctgccatggcaagggctaaaggctgcaacaaagaaacaaaaa
tatgaaaagattagtgaaaagaagatgtccactcctgttgaagttttgtgtaaggggttt
cctgcagaatttgccatgtacttaaattactgtcgtgggctgcgctttgaggaagctccg
gattacatgtatctgaggcagctattccgcatccttttcaggaccctgaaccaccaatat
gactacacatttgattggacaatgttaaagcagaaagcggcacagcaggcagcctcttcc
agtgggcagggtcagcaggcccaaacccccacaggcaagcaaactgacaaaaccaagagt
aacatgaaaggtattaaagacgagaagttggatccactgagttag

DBGET integrated database retrieval system