KEGG   Cricetulus griseus (Chinese hamster): 100758427Help
Entry
100758427         CDS       T02813                                 

Gene name
Gsto1
Definition
(RefSeq) glutathione S-transferase omega-1 isoform X4
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00480  Glutathione metabolism
cge00980  Metabolism of xenobiotics by cytochrome P450
cge00982  Drug metabolism - cytochrome P450
cge00983  Drug metabolism - other enzymes
cge01524  Platinum drug resistance
cge05200  Pathways in cancer
cge05204  Chemical carcinogenesis
cge05225  Hepatocellular carcinoma
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100758427 (Gsto1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100758427 (Gsto1)
   00982 Drug metabolism - cytochrome P450
    100758427 (Gsto1)
   00983 Drug metabolism - other enzymes
    100758427 (Gsto1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100758427 (Gsto1)
   05204 Chemical carcinogenesis
    100758427 (Gsto1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100758427 (Gsto1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100758427 (Gsto1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100758427 (Gsto1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100758427 (Gsto1)
Enzymes [BR:cge01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100758427 (Gsto1)
Transporters [BR:cge02000]
 Other Transporters
  Pores ion channels [TC:1]
   100758427 (Gsto1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin GST_N_4 Tom37
Motif
Other DBs
NCBI-GeneID: 100758427
NCBI-ProteinID: XP_027262854
LinkDB All DBs
Position
3
AA seq 240 aa AA seqDB search
MSGASSRSLGKGSSPPGPVPEGLIRIYSMRFCPFAQRALMVLKAKGIRHEIVNINLKNKP
EWFLKKNPTGLVPVLEDSKGRLISESVIICEYLDEAYPDKKLFPDDPYEKARQKMTLESF
SKVPLLVTRFVRGKKEDHPALKEELTKEFYKLEEAVTKYKKDFRVGDAVSMTDYLMWPWF
QWLEALELKECVAHTPKLKGWMAAMQKDPTVSSHLIDAKTYRGFVNLYLQDSPEACDYGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggcatcctccaggagcctggggaaaggaagctcgcctccgggtccggttcct
gagggcctgatccgcatctacagcatgaggttctgccccttcgctcagagggcactgatg
gtcctgaaggccaagggaatccgacatgaaatcgtcaacatcaacctgaaaaacaagccc
gaatggttcctcaagaagaatcccactgggctggtaccagttctggaggacagtaagggt
cgcttgatctccgaatctgtcatcatttgtgagtacttggatgaggcctaccctgacaag
aagctgttcccagatgacccttatgagaaagctcggcagaagatgaccttagagtcattc
tccaaggtgccccttttggttacaaggtttgttagggggaagaaggaagaccaccctgcg
ctaaaggaagaattgacgaaggaattctacaagctggaggaggctgtgactaagtataag
aaagacttccgtgttggggatgctgtctctatgactgattatctcatgtggccttggttt
caatggctggaagcactagagctcaaagagtgtgtggcccacactccaaaactgaagggc
tggatggctgccatgcagaaagaccccacagtatcatcgcacttaattgatgccaagacc
tatcgtggtttcgtaaatctctacctacaggacagccctgaggcctgtgactatgggctc
tga

DBGET integrated database retrieval system