KEGG   Cricetulus griseus (Chinese hamster): 100758936
Entry
100758936         CDS       T02813                                 

Gene name
Shc1
Definition
(RefSeq) SHC-transforming protein 1 isoform X1
  KO
K06279  SHC-transforming protein 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04510  Focal adhesion
cge04650  Natural killer cell mediated cytotoxicity
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05100  Bacterial invasion of epithelial cells
cge05206  MicroRNAs in cancer
cge05214  Glioma
cge05220  Chronic myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100758936 (Shc1)
   04014 Ras signaling pathway
    100758936 (Shc1)
   04072 Phospholipase D signaling pathway
    100758936 (Shc1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100758936 (Shc1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100758936 (Shc1)
   04062 Chemokine signaling pathway
    100758936 (Shc1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100758936 (Shc1)
   04915 Estrogen signaling pathway
    100758936 (Shc1)
   04917 Prolactin signaling pathway
    100758936 (Shc1)
   04926 Relaxin signaling pathway
    100758936 (Shc1)
   04935 Growth hormone synthesis, secretion and action
    100758936 (Shc1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100758936 (Shc1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100758936 (Shc1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100758936 (Shc1)
   05226 Gastric cancer
    100758936 (Shc1)
   05214 Glioma
    100758936 (Shc1)
   05220 Chronic myeloid leukemia
    100758936 (Shc1)
   05224 Breast cancer
    100758936 (Shc1)
  09165 Substance dependence
   05034 Alcoholism
    100758936 (Shc1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100758936 (Shc1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100758936 (Shc1)
   01522 Endocrine resistance
    100758936 (Shc1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100758936
NCBI-ProteinID: XP_027249042
UniProt: G3HC68
LinkDB
Position
1
AA seq 579 aa
MDLLPPKPKYNPLRNESLSSLEEGASGSTPTEELPSPSASSLGPILPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGNAGAALRDSGLLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAARPTLPTGQMPSHLGATLPIGQHAAGDPEVRKQMLPPPPCPGRELFDD
PSYVNIQNLDKARQAGVGAGPPNPSINGSAPRDLFDMKPFEDALRVPPPPQTMSMAEQLQ
GESWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRT
KDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVDRKA
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggatcttctaccccccaagccgaagtacaacccacttcgaaatgagtctctgtcatcg
ctggaggagggggcttcagggtctacccccacagaagagctgccttccccgtcagcctca
tccctgggacccattctgcctcctctgccgggggatgatagtccgactactctgtgttcc
ttctttccccggatgagcaacctgaagctggccaatcctgctggggggcgcctggggcct
aagggagagccaggaaaggctgctgaagatggggaagggaatgcaggggcagcccttcgg
gactcaggcctcttgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtagaagggggccagctggggggcgaggagtggaccagacacgggagcttt
gtcaataagcccacacgaggctggctgcatcccaacgacaaagtcatgggacctggggtt
tcctacttggttcggtacatgggttgtgtggaggtcctgcagtcaatgcgagcccttgac
ttcaatacccggactcaggtcaccagggaggccatcagtttggtgtgtgaagccgtgcct
ggtgccaaaggagccacaaggaggagaaagccctgtagccgcccactcagctctatcctg
gggaggagtaacctgaagtttgctggaatgccaatcactctcactgtgtctaccagcagc
cttaacctcatggcagccgactgcaaacagatcattgccaaccatcacatgcagtccatc
tcgttcgcgtctggtggggatccggacacagctgagtatgttgcctatgttgccaaagac
cccgtaaatcagagagcctgccatatcctggagtgtcctgaagggcttgctcaggatgtc
atcagcaccatcggtcaggcctttgagttgcgcttcaaacagtatctcaggaatccacct
aagctggtcaccccccatgacaggatggctggctttgatggctcagcttgggatgaggag
gaagaagaaccacctgaccatcagtactataatgacttcccagggaaggaaccccctctc
ggtggggtggtagacatgaggcttcgagaaggagctgctcgacccactctgcccactggc
cagatgcccagccacttgggagctacactgcctatagggcagcatgctgcaggagaccct
gaagtccgtaaacagatgttgcctccaccaccttgcccaggcagagaactcttcgatgac
ccttcctatgtcaacatccagaatctagacaaggcccggcaagctggggttggggctggg
cctcccaatccttccattaatggcagtgcaccccgagacctctttgacatgaagcccttt
gaagatgcccttcgggtgcctccacctcctcagaccatgtccatggctgagcagctccaa
ggggagtcctggttccatgggaagctgagccggcgggaggcagaagcactgctgcagctc
aacggtgacttcttggttcgagagagcacaaccacacctggccagtatgtgctcactggt
ctgcagagtgggcagcccaagcacctgcttctggtggatcctgaaggtgtggttcggaca
aaggatcaccgctttgagagtgtcagtcacctcattagctaccacatggacaatcacttg
cccatcatctctgcgggcagcgaactgtgtctacagcaacccgtggatcggaaggcgtga

KEGG   Cricetulus griseus (Chinese hamster): 100760879
Entry
100760879         CDS       T02813                                 

Gene name
Shc3
Definition
(RefSeq) SHC-transforming protein 3 isoform X2
  KO
K17448  SHC-transforming protein 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04510  Focal adhesion
cge04650  Natural killer cell mediated cytotoxicity
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05100  Bacterial invasion of epithelial cells
cge05214  Glioma
cge05220  Chronic myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100760879 (Shc3)
   04014 Ras signaling pathway
    100760879 (Shc3)
   04072 Phospholipase D signaling pathway
    100760879 (Shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100760879 (Shc3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100760879 (Shc3)
   04062 Chemokine signaling pathway
    100760879 (Shc3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100760879 (Shc3)
   04915 Estrogen signaling pathway
    100760879 (Shc3)
   04917 Prolactin signaling pathway
    100760879 (Shc3)
   04926 Relaxin signaling pathway
    100760879 (Shc3)
   04935 Growth hormone synthesis, secretion and action
    100760879 (Shc3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100760879 (Shc3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100760879 (Shc3)
   05226 Gastric cancer
    100760879 (Shc3)
   05214 Glioma
    100760879 (Shc3)
   05220 Chronic myeloid leukemia
    100760879 (Shc3)
   05224 Breast cancer
    100760879 (Shc3)
  09165 Substance dependence
   05034 Alcoholism
    100760879 (Shc3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100760879 (Shc3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100760879 (Shc3)
   01522 Endocrine resistance
    100760879 (Shc3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100760879
NCBI-ProteinID: XP_027265715
LinkDB
Position
3
AA seq 595 aa
MLPRTKYNRFRNDSVTSVDDLLHSLSVNGSGGKVSAEAPAATPYLVSGEALRKAPDDGPG
SLGHLLHKVSHLKLSSSGLRGLSSAARERAGARLSGSCSAPSLAAPDAGSATPGSRAQAA
SMSATKKSRAGDEPLPRPPRGAPHSNDQVLGPGVTYVVKYLGCIEVLRSMRSLDFSTRTQ
ITREAISRVCEAVPGAKGAFKKRKPPSKVLSNILGKSNLQFAGMSISLTISTASLNLRTP
DSKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQ
AFELRFKQYLQCPSKIPALQDRMQSLDEPWTEEEGDGPDHPYYNSVPSKMPPPGGFLDAR
LKARPHGPDAAQFAGKEQTYYQGRHLGDTFGEDWQRAPTRQGSLDIYSTPEGKAHMALVG
ETPTYVNTQPVPPHVWPTASSSTESSPRKDLFDMKPFEDALKNQPLGPVLSKAASVECIS
PVSPRAPDAKTLEELDAEPWYQGEMSRKEAEALLQEDGDFLVRKSTTNPGSFVLTGMHNG
QAKHLLLVDPEGTIRTKDRVFDSISHLINYHLESSLPIVSAGSELCLQQPVERKH
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgatgac
cttctccacagcctgtcggtgaacggcagcggcggcaaggtctcggcggaggcgcccgcg
gcgaccccctacctggtgtcgggcgaggcgctgcgcaaggcgccggacgatgggcccggc
agcctgggccacctgctccacaaggtgtcccacctgaaactctccagctccggcctgcgc
ggcctgtcgtccgccgcccgggagcgggctggcgcgcggctctcgggcagctgcagcgcg
cccagcctggctgccccggacgctggcagcgcgacccccgggtcccgcgcccaggccgcc
agcatgagcgccaccaagaagagccgggccggcgacgagccgctgcccaggcccccgcgg
ggcgcgcctcactccaacgaccaggtgctggggcccggagtcacctatgtggtcaagtac
ttgggatgcattgaagttctgcgctcaatgaggtctctcgacttcagtacaagaactcag
attaccagggaagccatcagccgtgtctgcgaagccgtgccaggtgccaaaggagccttc
aagaagagaaagcctccgagtaaagtgctgtccaacatcttggggaagagcaacctccag
tttgcaggcatgagcatctccttgaccatctccactgccagcctgaatctgcgcactccc
gactccaaacagatcatagcgaaccaccacatgcaatccatctccttcgcctcaggaggc
gacccggacacaacagactatgtcgcctatgtcgctaaggaccctgttaatcgcagagct
tgccatattctggagtgctgtgatgggctagcccaagatgtcattggctccatcggacaa
gcctttgaactccggttcaaacagtatctgcagtgtccctccaagattcctgctctccag
gaccgaatgcagagtctagatgagccttggactgaagaggagggagatggccctgatcac
ccatactacaacagtgtccccagcaagatgcctcctccagggggatttcttgatgctcga
ttgaaagccagaccccatggtcctgatgcagctcagtttgcagggaaagagcaaacttat
taccagggaagacacttaggagacacatttggtgaagactggcagcgagcacccaccagg
caaggttccttggatatctacagcactccagaagggaaagcgcacatggctctagtagga
gagacaccaacctatgtcaacactcagccagtccctccccatgtttggcccacagcaagc
agcagcaccgagagcagcccacgcaaggacctctttgacatgaagccttttgaagatgct
ctcaagaaccagcccctggggcccgtgctgagcaaagcagcatctgtggagtgcatcagc
cccgtctcacccagagccccagatgccaagacgctggaggagctggatgctgagccctgg
taccaaggagagatgagcaggaaggaggcagaggcactgctgcaggaagatggagacttc
ctagtcagaaagagtactaccaaccctggttcctttgtcctcacgggcatgcacaatggc
caggccaagcacctgctgctagtggacccggaaggcacgatccggaccaaggaccgggtc
ttcgacagcatcagtcacctcatcaactaccatcttgagagcagcctgcccatcgtctct
gctggtagtgagctttgcctccagcaaccagtggagaggaaacactga

KEGG   Cricetulus griseus (Chinese hamster): 100761269
Entry
100761269         CDS       T02813                                 

Gene name
Shc2
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04370  VEGF signaling pathway
cge04510  Focal adhesion
cge04650  Natural killer cell mediated cytotoxicity
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05100  Bacterial invasion of epithelial cells
cge05214  Glioma
cge05220  Chronic myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100761269 (Shc2)
   04014 Ras signaling pathway
    100761269 (Shc2)
   04370 VEGF signaling pathway
    100761269 (Shc2)
   04072 Phospholipase D signaling pathway
    100761269 (Shc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100761269 (Shc2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100761269 (Shc2)
   04062 Chemokine signaling pathway
    100761269 (Shc2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100761269 (Shc2)
   04915 Estrogen signaling pathway
    100761269 (Shc2)
   04917 Prolactin signaling pathway
    100761269 (Shc2)
   04926 Relaxin signaling pathway
    100761269 (Shc2)
   04935 Growth hormone synthesis, secretion and action
    100761269 (Shc2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100761269 (Shc2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100761269 (Shc2)
   05226 Gastric cancer
    100761269 (Shc2)
   05214 Glioma
    100761269 (Shc2)
   05220 Chronic myeloid leukemia
    100761269 (Shc2)
   05224 Breast cancer
    100761269 (Shc2)
  09165 Substance dependence
   05034 Alcoholism
    100761269 (Shc2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100761269 (Shc2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100761269 (Shc2)
   01522 Endocrine resistance
    100761269 (Shc2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 100761269
NCBI-ProteinID: XP_035301820
UniProt: G3HF31
LinkDB
Position
5
AA seq 573 aa
MTQGPGGRAAPEPEAPTTFCALLPRMPQWKFASPGGFLGRGPAAARAAGAADAQPEPGVP
ALAAVLGACEPRCAAPCPLPALSRCRGSGTRGRGGXPDVADEWARKGGFIHKPAHGWLHP
DARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTREAINRLHEAVPGVRGSWKKKAS
NKALASILGKSNLRFAGMSISVNISVDGLNLSVPATRQIIANHHMQSISFASGGDSDMTD
YVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFELRFKQYLHSPPKAVMPPERLTGL
EESAWGDGDEALDHNYYNSIPGKEPPLGGLVDSRLAVTQPCALATLGGPGQGMSPAWREA
RGLPWDMGLSGAVLPGDGYVQADARGPRDYEEHLYVNTQGLDAIEPEDISEAPLMPEDSP
KKDLFDMRPFEDALKLHECSVAASITSVPFPLEDQWPSPPTRRAPIAPTEEQLRQEPWYH
GRMSRRAAEKLLRADGDFLVRDSITNPGQYVLTGMHAGQPKHLLLVDPEGVVRTKDVLFE
SISHLIDYHLKNGLPIVAAESELHLRGVVSREP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgacgcagggtccgggtggccgcgcggccccggagcccgaggcgcccaccaccttctgc
gcgctgctgccgcgcatgccgcaatggaagttcgcgtcacccggcggcttcctgggtcgc
ggtccggcggcagcgcgcgcggcgggggcggcagatgcgcagcccgaacccggggtccct
gcgctggcagcggtgctgggcgcttgcgaaccgcgctgcgccgcgccctgccctctgccc
gcgctcagccgctgccggggctcggggacgcggggacgcgggggancccccgacgtcgcc
gacgagtgggcgcgcaagggcggcttcatccacaagccggcgcacggctggctgcacccc
gacgccagggtcctggggcccggggtctcctacatcgtgcggtacatgggctgtattgag
gtgctccgatccatgcgctctctggatttcaacacccgaacgcaagtgacgagggaagcc
atcaaccggctccatgaggccgtgcccggtgtccggggctcctggaagaagaaggcctcc
aacaaggcactggcctccatcctggggaagagcaacctgcgtttcgctggtatgagcatc
tcggtcaacatctccgtggatggtctcaacctgtctgttcctgccacccgccagatcatc
gccaaccatcatatgcagtctatttccttcgcttctggtggtgactcggacatgactgat
tacgtggcctatgtggccaaggaccccatcaaccagagagcctgccacatcttagaatgc
tgtgaaggtctagcccagagcatcatcagcactgtaggccaagcctttgagctacgcttc
aagcaatacctgcacagtccccccaaggctgtaatgccccccgaaaggctgacagggctg
gaggagtcagcttggggtgacggtgatgaggctctggaccacaattactacaacagcatt
ccagggaaggagccacctctgggtgggctggtggactccagactggctgtcacacagccc
tgtgcactggcgacactagggggcccgggacagggaatgtcacctgcatggagagaagcc
cgtggcttgccctgggatatgggtctctccggagcagtcctacctggggatggctatgtg
caggcagatgctcgaggaccacgtgactacgaggagcacctgtatgtcaacacccagggc
ctggacgctatcgagcctgaggacatttctgaggcacctctgatgcctgaggacagcccc
aagaaggacctgtttgacatgcgaccctttgaggatgccctgaagttgcacgagtgctca
gtggcagccagcatcacttcagtcccattccctttggaggaccagtggcccagcccccct
acccgcagggcccccattgcacccacagaggagcaattgaggcaggagccctggtaccat
ggacggatgagccgtcgggctgcggagaagctgcttcgtgccgatggggacttccttgtg
agagacagcatcaccaacccggggcagtatgtcctcacaggcatgcacgcagggcagccc
aaacacctgctgctggtggaccctgagggcgtggtgcggacgaaagacgtgttgtttgag
agcatcagccacctcatagactaccacctgaagaatgggctgcccatcgtggctgcggag
agtgagctgcaccttcggggagtggtctcccgggagccatga

KEGG   Cricetulus griseus (Chinese hamster): 100763505
Entry
100763505         CDS       T02813                                 

Gene name
Shc4
Definition
(RefSeq) SHC-transforming protein 4 isoform X2
  KO
K17449  SHC-transforming protein 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04072  Phospholipase D signaling pathway
cge04510  Focal adhesion
cge04650  Natural killer cell mediated cytotoxicity
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04915  Estrogen signaling pathway
cge04917  Prolactin signaling pathway
cge04926  Relaxin signaling pathway
cge04935  Growth hormone synthesis, secretion and action
cge05034  Alcoholism
cge05100  Bacterial invasion of epithelial cells
cge05206  MicroRNAs in cancer
cge05214  Glioma
cge05220  Chronic myeloid leukemia
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100763505 (Shc4)
   04014 Ras signaling pathway
    100763505 (Shc4)
   04072 Phospholipase D signaling pathway
    100763505 (Shc4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100763505 (Shc4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100763505 (Shc4)
   04062 Chemokine signaling pathway
    100763505 (Shc4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100763505 (Shc4)
   04915 Estrogen signaling pathway
    100763505 (Shc4)
   04917 Prolactin signaling pathway
    100763505 (Shc4)
   04926 Relaxin signaling pathway
    100763505 (Shc4)
   04935 Growth hormone synthesis, secretion and action
    100763505 (Shc4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100763505 (Shc4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100763505 (Shc4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100763505 (Shc4)
   05226 Gastric cancer
    100763505 (Shc4)
   05214 Glioma
    100763505 (Shc4)
   05220 Chronic myeloid leukemia
    100763505 (Shc4)
   05224 Breast cancer
    100763505 (Shc4)
  09165 Substance dependence
   05034 Alcoholism
    100763505 (Shc4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100763505 (Shc4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100763505 (Shc4)
   01522 Endocrine resistance
    100763505 (Shc4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 100763505
NCBI-ProteinID: XP_027277754
LinkDB
Position
6
AA seq 630 aa
MRERGQDGQAGLALYVGLFGHLGMLHRAKYSRFRNESITSLDEGSSGGSVGNKGSSPPPY
PALAPHLPAEDATVPTQESPTALCTLIPRMASMKLANPVTFLSLKTFCLGTKEVPRLKLQ
ESQDQATSSPASPETSLNRTGPAPTPHPHLHPDQVGRRTTPLSPDACPLPGPGQPIPRSR
QDKHSPQHLLGSGLNYCVRYMGCIEVLKSMRSLDFGMRTQVTREAISRLCDAVPGAHGAI
KKRKAPVKFLSAVLGKSNLQFSGMNIKLTVSTCSLTLMNLDNQQIIAKHQMQSISFASGG
DPDTTDYVAYVAKDPVNQRACHILECHSGMAQDVISTIGQAFELRFKQYLKNPSVNTWES
EEVRVEGTSEDRDHAYYNAMPRKLPPAGGISDVRIRVQATDQMAYCPIRCEKLCYLPVNS
KCRGVYENCTGQRGSIGIPHQRGMHGDAALMKHACRVDLFDDPCYVNTQALQSTRGYAAN
QSSIQPHGSTWHIGKAPETVQPGARAQSMSSYSLPHIKQQLWSEECFHGRLSRGAAERLL
VKDGDFLVRESMTSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIKYHMDN
SLPIISSGSEVSLKQPVRKDNNTRLLHYKK
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgcgagaacgcggccaggacggccaggcaggactcgctctgtatgtaggactctttggg
cacctggggatgcttcacagggccaagtacagccgctttcggaatgagtccatcacgtct
ttggatgaagggagctccggaggctcggttggaaacaagggctcgtcgccgcctccctac
ccagccctggcccctcacctgccggctgaagatgccactgtgcccacccaggagagcccc
actgcgctgtgcaccttgatcccccgtatggcaagcatgaagctggccaacccagtcact
tttctgagtctgaaaaccttttgcctgggtaccaaagaggtaccccggctgaagctccaa
gagagccaggatcaggctacaagcagtccagcttccccagaaaccagtctaaacaggact
gggcctgctcctacaccgcatccgcatctgcatccggaccaggtgggacgcaggacaacc
cccttgtctcctgatgcttgcccactgcctggccctggacaaccaatccccaggagtagg
caggataagcattctccgcagcacctgttggggtccggtctgaactactgtgtgaggtac
atgggctgcattgaagtgctgaaatcaatgaggtcactggattttgggatgagaacccaa
gttacaagggaagcaataagccgcctgtgtgatgctgtccccggggcccacggagccatt
aaaaagcgaaaggctcctgttaagttcctgtcagcggttcttggcaaaagcaatcttcag
ttttcgggaatgaatataaagctgactgtttcgacctgcagcctcacactgatgaacctt
gacaaccaacagattattgcaaagcatcaaatgcaatcgatttcatttgcctctggaggg
gaccctgataccacagactatgttgcctatgttgctaaagatccagtcaatcaacgagca
tgccacatactagaatgtcacagtggaatggcccaagatgttataagcaccatagggcag
gcctttgaactccggttcaaacagtatctgaaaaatccttccgtgaacacttgggaaagt
gaagaggtacgtgtggaaggcacatctgaagacagagatcatgcctattacaacgcaatg
ccacggaaactgccacctgcaggtggcatttcagatgtgaggatcagggttcaagctaca
gaccaaatggcctactgccctattcggtgtgagaagctgtgctacttgcccgtgaactct
aagtgccgcggtgtgtatgagaactgtacgggacagcgtgggtcaataggtattccccac
cagagagggatgcacggtgatgctgcattgatgaagcatgcctgccgagtggatctattt
gacgacccttgctatgtcaatacccaggctcttcagagtacccgtggctatgctgcaaat
cagagctcaattcagccacatggaagcacatggcacattggaaaggcaccagaaactgta
cagccaggagccagagcccagtccatgagctcatactctctgccacacattaagcagcaa
ctatggagtgaagaatgcttccacggcaggctaagcaggggggcagcagaaagacttttg
gtgaaggatggggactttttggttcgagagagtatgacatctcctggccagtatgtgttg
agtggactacaaggtggccaggcgaagcacctcctcttggtggatcctgaaggcaaggtg
aggaccaaggaccatgtgtttgacaatgttggccaccttatcaaataccatatggataac
agtttgccaatcatctcttctggaagtgaagtaagccttaaacaaccagtaagaaaagac
aataatacaagacttctgcattataagaaatga

DBGET integrated database retrieval system