KEGG   Cricetulus griseus (Chinese hamster): 100759195Help
Entry
100759195         CDS       T02813                                 

Gene name
Park7
Definition
(RefSeq) Parkinsonism associated deglycase
  KO
K05687  protein DJ-1 [EC:3.5.1.124]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    100759195 (Park7)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.124  protein deglycase
     100759195 (Park7)
Peptidases [BR:cge01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   100759195 (Park7)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100759195 (Park7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI ThiJ_like GATase_3 MlrC_C
Motif
Other DBs
NCBI-GeneID: 100759195
NCBI-ProteinID: XP_003513352
UniProt: G3IEU2
LinkDB All DBs
Position
3
AA seq 189 aa AA seqDB search
MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTIAGLAGKDPVQCSRDVMICPDTSLED
AKKQGPYDVVVLPGGNLGAQNLSESAVVKEILKEQESRKGLIAAICAGPTALLAHEIGFG
SKVTTHPGAKDKMINGGHYSYTESRVERDGLILTSQGPGTSFEFALAIVEALSGKEMADK
VKAPLLLKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaagagctctggtcatcctggccaaaggtgcagaggagatggagacggtg
attcccgtggatgtcatgcgacgagctgggattaaagtcactattgcaggcctggctggg
aaagaccccgtgcagtgtagccgtgatgtaatgatttgtcctgacaccagtcttgaagat
gcaaaaaagcagggaccatacgacgtggtggttcttccaggaggcaatctgggtgcacag
aatttatctgagtcagctgtggtgaaggagatcttgaaggagcaggaaagcaggaagggc
ctcatagctgccatctgtgcaggtcctaccgctctgttggctcatgaaatcggttttgga
agcaaggtcacaacacacccaggggctaaggacaaaatgataaatggtggtcactacagc
tacacagaaagccgtgtggaaagggatggcctgatcctcaccagccaagggcctgggacc
agcttcgagtttgcgctggccattgtggaggcactcagtggcaaggagatggctgacaaa
gtgaaggcaccgcttctcctcaaggactag

DBGET integrated database retrieval system