KEGG   Cricetulus griseus (Chinese hamster): 100759220
Entry
100759220         CDS       T02813                                 

Gene name
Smad3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04144  Endocytosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04350  TGF-beta signaling pathway
cge04371  Apelin signaling pathway
cge04390  Hippo signaling pathway
cge04520  Adherens junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04659  Th17 cell differentiation
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05161  Hepatitis B
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100759220 (Smad3)
   04350 TGF-beta signaling pathway
    100759220 (Smad3)
   04390 Hippo signaling pathway
    100759220 (Smad3)
   04371 Apelin signaling pathway
    100759220 (Smad3)
   04068 FoxO signaling pathway
    100759220 (Smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100759220 (Smad3)
  09143 Cell growth and death
   04110 Cell cycle
    100759220 (Smad3)
   04218 Cellular senescence
    100759220 (Smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100759220 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100759220 (Smad3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100759220 (Smad3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100759220 (Smad3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100759220 (Smad3)
   05212 Pancreatic cancer
    100759220 (Smad3)
   05225 Hepatocellular carcinoma
    100759220 (Smad3)
   05226 Gastric cancer
    100759220 (Smad3)
   05220 Chronic myeloid leukemia
    100759220 (Smad3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100759220 (Smad3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100759220 (Smad3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100759220 (Smad3)
   05161 Hepatitis B
    100759220 (Smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100759220
NCBI-ProteinID: XP_027270585
UniProt: A0A061I1W0
LinkDB
Position
4
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMSHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccctccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaatgggcaggaggagaaatggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacacagaacgtg
aacaccaagtgcattaccatccccaggtcactggatggccggctgcaagtgtcccatcgg
aaggggcttccccatgttatctactgccgcctgtggcgatggcctgacctgcacagtcac
catgagttacgggccatggagctatgtgagtttgcctttaacatgaagaaggacgaagtg
tgcgtcaatccgtaccactatcagagagtagagacaccagttctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttccccccgctggatgactacagccattccatc
cctgagaacactaacttccccgctggcattgagccccaaagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagaaactagtgaccaccagatgagccacagcatg
gatgcaggctctccaaacctatccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtgacctactgtgagccagccttctggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcctcacagccatccatgacagtagatggcttc
accgatccctccaactcagagcgcttctgcctgggcctgctgtccaatgtcaatcggaat
gcagctgtggaacttactagacggcacattgggagaggcgtgcggctctactacattgga
ggggaggtctttgcagagtgtctcagtgacagtgctatttttgttcagtcacccaactgc
aaccagcgctatggctggcaccctgccaccgtctgcaagatccctccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgccctcctggcccagtctgtcaaccagggcttt
gaggctgtctaccagttgactcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggagcggagtacaggagacagacagtgaccagtaccccctgctggatcgagctgcacctg
aatgggcccttgcagtggcttgacaaggtcctcacccagatgggctcccccagcattcgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system