KEGG   Cricetulus griseus (Chinese hamster): 100759228
Entry
100759228         CDS       T02813                                 

Gene name
Gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100759228 (Gadd45g)
   04064 NF-kappa B signaling pathway
    100759228 (Gadd45g)
   04068 FoxO signaling pathway
    100759228 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100759228 (Gadd45g)
   04210 Apoptosis
    100759228 (Gadd45g)
   04115 p53 signaling pathway
    100759228 (Gadd45g)
   04218 Cellular senescence
    100759228 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100759228 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    100759228 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100759228 (Gadd45g)
   05212 Pancreatic cancer
    100759228 (Gadd45g)
   05225 Hepatocellular carcinoma
    100759228 (Gadd45g)
   05226 Gastric cancer
    100759228 (Gadd45g)
   05214 Glioma
    100759228 (Gadd45g)
   05216 Thyroid cancer
    100759228 (Gadd45g)
   05220 Chronic myeloid leukemia
    100759228 (Gadd45g)
   05217 Basal cell carcinoma
    100759228 (Gadd45g)
   05218 Melanoma
    100759228 (Gadd45g)
   05213 Endometrial cancer
    100759228 (Gadd45g)
   05224 Breast cancer
    100759228 (Gadd45g)
   05222 Small cell lung cancer
    100759228 (Gadd45g)
   05223 Non-small cell lung cancer
    100759228 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100759228 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100759228 (Gadd45g)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100759228 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100759228 (Gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100759228
NCBI-ProteinID: XP_027265837
UniProt: A0A061IBJ3
LinkDB
Position
3
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGADDEAGAPGDLHCI
LISNPNEDTWKDPALEKLSVFCEESRSFNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggatacagttccggaaagcacagccaggatgcag
ggcgccgggaaagcgctgcacgaacttctgctgtcggcgcagcgccagggctgtctgacc
gctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttttgc
gtgctggctgccgatgaagaagatgagggcgacatagcgctgcagatccatttcacgctg
atccaggcgttctgctgtgagaacgacattgacatcgtgcgcgtgggtgatgttcagcgg
ctagcggcgatcgtgggtgcggacgacgaggcgggcgcgccgggggacctgcactgcata
ctcatttcgaatcctaatgaggacacgtggaaggaccctgctttggagaaactcagcgtg
ttctgcgaggaaagccgcagcttcaacgactgggtgcccagcattacacttcccgagtga

KEGG   Cricetulus griseus (Chinese hamster): 100766127
Entry
100766127         CDS       T02813                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100766127 (Gadd45b)
   04064 NF-kappa B signaling pathway
    100766127 (Gadd45b)
   04068 FoxO signaling pathway
    100766127 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100766127 (Gadd45b)
   04210 Apoptosis
    100766127 (Gadd45b)
   04115 p53 signaling pathway
    100766127 (Gadd45b)
   04218 Cellular senescence
    100766127 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766127 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    100766127 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100766127 (Gadd45b)
   05212 Pancreatic cancer
    100766127 (Gadd45b)
   05225 Hepatocellular carcinoma
    100766127 (Gadd45b)
   05226 Gastric cancer
    100766127 (Gadd45b)
   05214 Glioma
    100766127 (Gadd45b)
   05216 Thyroid cancer
    100766127 (Gadd45b)
   05220 Chronic myeloid leukemia
    100766127 (Gadd45b)
   05217 Basal cell carcinoma
    100766127 (Gadd45b)
   05218 Melanoma
    100766127 (Gadd45b)
   05213 Endometrial cancer
    100766127 (Gadd45b)
   05224 Breast cancer
    100766127 (Gadd45b)
   05222 Small cell lung cancer
    100766127 (Gadd45b)
   05223 Non-small cell lung cancer
    100766127 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100766127 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100766127 (Gadd45b)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100766127 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100766127 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100766127
NCBI-ProteinID: XP_027275094
UniProt: A0A3L7HHR9
LinkDB
Position
5
AA seq 160 aa
MTLEELVASDNAAQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCL
LVTNCHTDTWKSQGLVEVASYCEESRGNNQWVPYISLEER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgacgctggaagagctggtggcgagcgacaacgcggctcagaagatgcaggcggtgacc
gccgcggtggaacagctgctggtggccgcgcagcgtcaggatcgcctcaccgtgggggtg
tacgaggcggccaaactgatgaatgtggaccctgacagtgtagtcctgtgcctcctagcc
atagacgaagaggaggaagatgacatcgccctgcagatccacttcacactgatccagtcg
ttctgctgtgacaatgacattgacatcgtccgggtatccggtatgcagaggctggcacag
ctcctgggcgagcccgcagaaaccctgggcaccactgaggcccgagacctgcattgcctc
ctggtcacgaactgtcacacagatacctggaaaagccaaggcttggtcgaggtggccagt
tactgtgaggagagcagaggcaataaccaatgggtcccttatatctctctggaggaacgc
tga

KEGG   Cricetulus griseus (Chinese hamster): 103159266
Entry
103159266         CDS       T02813                                 

Gene name
Gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X2
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103159266 (Gadd45a)
   04064 NF-kappa B signaling pathway
    103159266 (Gadd45a)
   04068 FoxO signaling pathway
    103159266 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103159266 (Gadd45a)
   04210 Apoptosis
    103159266 (Gadd45a)
   04115 p53 signaling pathway
    103159266 (Gadd45a)
   04218 Cellular senescence
    103159266 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103159266 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    103159266 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103159266 (Gadd45a)
   05212 Pancreatic cancer
    103159266 (Gadd45a)
   05225 Hepatocellular carcinoma
    103159266 (Gadd45a)
   05226 Gastric cancer
    103159266 (Gadd45a)
   05214 Glioma
    103159266 (Gadd45a)
   05216 Thyroid cancer
    103159266 (Gadd45a)
   05220 Chronic myeloid leukemia
    103159266 (Gadd45a)
   05217 Basal cell carcinoma
    103159266 (Gadd45a)
   05218 Melanoma
    103159266 (Gadd45a)
   05213 Endometrial cancer
    103159266 (Gadd45a)
   05224 Breast cancer
    103159266 (Gadd45a)
   05222 Small cell lung cancer
    103159266 (Gadd45a)
   05223 Non-small cell lung cancer
    103159266 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103159266 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    103159266 (Gadd45a)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103159266 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103159266 (Gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103159266
NCBI-ProteinID: XP_027286031
LinkDB
Position
8
AA seq 165 aa
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLESDAGPAESGGASQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggccgcagagcagaagaccgaaaggatggacacggtggga
gatgccctggaggaagtgctcagcaaggcgcggagtcagcgcaccatcaccgtcggcgtg
tacgaggccgccaagttgctcaatgtcgaccccgacaacgtggtactgtgcctgctggct
gcagacgaggacgacgacagggacgtggctctgcagatccattttaccctcatccaggcg
ttctgctgcgagaacgacatcaacatcctgcgggtcagcaacccgggccggctggctgag
ctgctgctgctggagagcgacgcgggcccggcggagagcgggggtgcctcgcagccccct
gacctgcactgcgtgctggtgacgaacccacattcatcacagtggaaggatcctgcctta
agtcaacttatttgcttttgtcgggaaagtcgctacatggatcagtgggttccagtgatt
aatctccccgaacggtga

DBGET integrated database retrieval system