KEGG   Cricetulus griseus (Chinese hamster): 100759437Help
Entry
100759437         CDS       T02813                                 

Definition
(RefSeq) uncharacterized LOC100759437
  KO
K11253  histone H3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge05034  Alcoholism
cge05202  Transcriptional misregulation in cancer
cge05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:cge00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100759437
  Immune diseases
   05322 Systemic lupus erythematosus
    100759437
  Substance dependence
   05034 Alcoholism
    100759437
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    100759437
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100759437
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TFIID-31kDa PAF FlaA
Motif
Other DBs
NCBI-GeneID: 100759437
NCBI-ProteinID: XP_003505638
LinkDB All DBs
Position
Un
AA seq 316 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERFLGYARIIFTLKTQLVHLKEDVGDELPFYYWIETRTNPMSGSMIE
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtactaagcagaccgctcgcaagtccaccggcggcaaggccccgcgcaagcag
ttggccaccaaggctgctcgcaagagcgcccctgccaccggcggcgtgaagaagcctcac
cgctaccggcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgag
ctgttgatccgtaagctgccgttccagcgcctggtgcgcgagatcgcgcaggatttcaag
acagacctgcgcttccagagctcagccgttatggctctgcaggaggctagcgaggcatat
ctcgttggtctgtttgaggacaccaacctgtgcgctattcacgccaagcgagtcaccatc
atgcccaaggacatccagctggcccgccgcattcgtggggaaaggttcctggggtatgct
agaataatttttacgctaaaaacgcaactcgtacatttaaaagaggacgtaggcgacgaa
ctacccttttattactggattgaaacgcggaccaatcccatgtctggatctatgattgaa
atggctcgtaccaagcagacagctcgcaagtccactggcggcaaggccccgcgcaagcag
ctggccaccaaagctgctcgcaagagcgccccagcgactggcggcgtgaagaagcctcac
cgctaccggcccggcaccgtggctctgcgcgagatccggcgctaccagaagtccaccgag
ctgttgatccgtaagctgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctctgcagtcatggcgctgcaggaggcctgtgaggcctac
ctggtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgagtcaccatc
atgcccaaggacatccagctggcccgccgcatccgcggggagagggcttag

DBGET integrated database retrieval system