KEGG   Cricetulus griseus (Chinese hamster): 100759649
Entry
100759649         CDS       T02813                                 

Gene name
Ccna2
Definition
(RefSeq) cyclin-A2 isoform X2
  KO
K06627  cyclin-A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04152  AMPK signaling pathway
cge04218  Cellular senescence
cge04914  Progesterone-mediated oocyte maturation
cge05161  Hepatitis B
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100759649 (Ccna2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100759649 (Ccna2)
   04218 Cellular senescence
    100759649 (Ccna2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100759649 (Ccna2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100759649 (Ccna2)
   05202 Transcriptional misregulation in cancer
    100759649 (Ccna2)
   05203 Viral carcinogenesis
    100759649 (Ccna2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100759649 (Ccna2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100759649 (Ccna2)
   05161 Hepatitis B
    100759649 (Ccna2)
   05169 Epstein-Barr virus infection
    100759649 (Ccna2)
   05165 Human papillomavirus infection
    100759649 (Ccna2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100759649 (Ccna2)
   03036 Chromosome and associated proteins [BR:cge03036]
    100759649 (Ccna2)
DNA replication proteins [BR:cge03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100759649 (Ccna2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100759649 (Ccna2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_N2 Cyclin_C
Other DBs
NCBI-GeneID: 100759649
NCBI-ProteinID: XP_027247782
LinkDB
Position
1
AA seq 423 aa
MPGSSRQSGREAGSALVSLQQEDQENVNPEKVAPAQQPRARAALKAGNARGNAPQQRLKT
RRVAPLKDLSINDEHVAVGPSWKATSKQPAFTIHVDEEEETQKMPAEHKETQCEDALAFN
AAVSLPGARKPLVPLDYPMDGSFESPHAMDMSIVLEDEKPVNVNEVPDYHEDIHTYLREM
EVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVL
RGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAP
TVNQFLNQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSLIAGAAFHLALYTVTG
QSWPESLVQKTGYTLESLKPCLMDLHQTYLRAAQHAQQSIREKYKHSKYHGVSLLNPPET
LNV
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgccgggcagctcgagacagtcgggtcgcgaggcgggctcagccctggtctcgctgcag
caggaagaccaggaaaatgtcaaccccgagaaggtggcgccagcccagcagccgcgggcg
cgggcggccctcaaggccgggaacgcgcggggaaacgcgccacagcagagactcaagact
cggcgggttgcacctcttaaagacctttctataaacgatgaacatgtcgccgttggtcct
tcatggaaagcaaccagtaaacagccggccttcactattcatgtggatgaagaagaggag
actcagaaaatgccagctgaacataaagaaacacagtgtgaagatgccctggcttttaat
gctgctgtctctttacctggagcaagaaaaccactggtacctcttgattatccaatggat
ggtagctttgaatcaccacatgctatggacatgtctattgtcttagaagacgaaaagcca
gtgaatgttaatgaagtacccgactatcatgaagatattcacacataccttagggaaatg
gaggttaaatgtaaacctaaagtgggttatatgaagaagcagccagacatcactaacagt
atgcgggccatccttgtggactggctagttgaagtgggagaagaatataaattacagaat
gagactctgcatttggctgtgaactacattgatcggttcctctcttccatgtctgtgtta
agaggaaagcttcaacttgtgggcactgctgctatgctgctagcttcaaaatttgaagaa
atataccccccagaagtagcagagtttgtgtatattacagacgatacctattccaagaag
caggttctgagaatggagcacctagtattgaaagtccttgcttttgacttagctgcgcca
acagtaaatcagtttcttaaccagtactttctgcaccagcagcctgcaaactgcaaagtt
gaaagcttagcaatgtttttgggagaattaagtttgatagatgctgacccatacctaaag
tatttgccatcactcattgctggagctgcctttcatttagcactctatacagtcacagga
caaagctggcctgagtcattggtacaaaagactggatataccctggaaagtcttaaacct
tgtctcatggaccttcaccagacctacctcagagcagcacagcatgctcaacagtcaata
agggaaaagtacaaacattcaaaataccatggtgtttctcttctcaacccaccagagaca
ctaaatgtgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100769969
Entry
100769969         CDS       T02813                                 

Gene name
Ccna1
Definition
(RefSeq) cyclin-A1 isoform X2
  KO
K06627  cyclin-A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04152  AMPK signaling pathway
cge04218  Cellular senescence
cge04914  Progesterone-mediated oocyte maturation
cge05161  Hepatitis B
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100769969 (Ccna1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100769969 (Ccna1)
   04218 Cellular senescence
    100769969 (Ccna1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100769969 (Ccna1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769969 (Ccna1)
   05202 Transcriptional misregulation in cancer
    100769969 (Ccna1)
   05203 Viral carcinogenesis
    100769969 (Ccna1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100769969 (Ccna1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100769969 (Ccna1)
   05161 Hepatitis B
    100769969 (Ccna1)
   05169 Epstein-Barr virus infection
    100769969 (Ccna1)
   05165 Human papillomavirus infection
    100769969 (Ccna1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cge03032]
    100769969 (Ccna1)
   03036 Chromosome and associated proteins [BR:cge03036]
    100769969 (Ccna1)
DNA replication proteins [BR:cge03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100769969 (Ccna1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100769969 (Ccna1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2 Peroxidase_2
Other DBs
NCBI-GeneID: 100769969
NCBI-ProteinID: XP_027250720
LinkDB
Position
1
AA seq 421 aa
MRRHSSKSGVALPPVGQGPEACQMLTRAQLGQDPPQRTVLGVLTENEQYRRTCGQEITTI
RCFSGSENVFPVAGKKVLPDHGVNEPAKHGFDIYMDEPEQRDRDTCPGREGIVFEDVYEV
DTSMLKSDLHFLLDFNTVSPMLVDSNAHAQSEEATDLGSDVINVTEYAEEIHRYLREAEV
RHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLVAAAAYCLANYIVNRHFW
PETLAAFTGYSLSEIVPCLSELHKACLSLPHRPQQAIREKYKTSKYLHVSLMEPPVVLPL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgcgtcgccacagctccaagagtggagtcgctctccctccagtgggccaaggtcccgag
gcttgtcaaatgctcactagagctcagctcggccaggatcccccacagagaaccgtgcta
ggggtgttgactgaaaatgagcagtacaggaggacctgtggccaggagatcacaacaatt
agatgtttttctggatcagaaaatgtcttccctgtggctggaaagaaagtgctccctgac
catggagtcaatgagccagccaagcacggatttgatatctacatggatgagcctgaacag
cgggaccgggacacctgcccagggagagaggggatagtatttgaggacgtgtatgaagta
gacacaagcatgctcaagtcagacctccacttcctgctggatttcaacacagtttcccca
atgttggtcgactccaatgcccatgcccagtcggaggaagcgacagatcttggttcagat
gtgattaatgtaacagaatatgctgaagagattcatcgttacctccgagaagctgaagta
agacacagacccaaggctcactacatgaggaagcagccagacatcacagaaggcatgcgc
gccatcctggtggactggctggtggaggttggggaagaatataaacttcgcacagagacc
ctgtacttggctgtcaacttcctggacaggtttctttcctgcatgtctgttctgagaggg
aaattgcagcttgtcgggacagcagctatcctcctagcttcgaaatatgaagagatatac
ccgccagatgtggatgagtttgtctacatcactgacgacacgtacactaagcgacagctc
ctaaggatggagcatctgctattgaaagttctagcatttgatttgactgttccaaccacc
aaccagtttctccttcagtacttaaggcggcaaggagtgtgcatcagaaccgagaacctg
gccaagtatgttgcagaactgagccttcttgaagctgacccattcttgaaatatcttcct
tccttggtagctgcagcagcttactgtctggcaaactacattgtgaacaggcacttctgg
ccagaaacgcttgctgcatttacgggctattcattaagtgaaattgtgccttgcctgagt
gagctgcataaagcctgcctcagtttaccccatcgacctcagcaagcaatcagggagaag
tataagacttcaaagtacctgcacgtgtccctcatggagccacctgtagttcttcctctg
cagtga

DBGET integrated database retrieval system