KEGG   Cricetulus griseus (Chinese hamster): 100759762
Entry
100759762         CDS       T02813                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X6
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04920  Adipocytokine signaling pathway
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05212  Pancreatic cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05340  Primary immunodeficiency
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100759762 (Ikbkg)
   04014 Ras signaling pathway
    100759762 (Ikbkg)
   04064 NF-kappa B signaling pathway
    100759762 (Ikbkg)
   04668 TNF signaling pathway
    100759762 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    100759762 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100759762 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100759762 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    100759762 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    100759762 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    100759762 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    100759762 (Ikbkg)
   04660 T cell receptor signaling pathway
    100759762 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    100759762 (Ikbkg)
   04659 Th17 cell differentiation
    100759762 (Ikbkg)
   04657 IL-17 signaling pathway
    100759762 (Ikbkg)
   04662 B cell receptor signaling pathway
    100759762 (Ikbkg)
   04062 Chemokine signaling pathway
    100759762 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100759762 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100759762 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100759762 (Ikbkg)
   05203 Viral carcinogenesis
    100759762 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100759762 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100759762 (Ikbkg)
   05221 Acute myeloid leukemia
    100759762 (Ikbkg)
   05220 Chronic myeloid leukemia
    100759762 (Ikbkg)
   05215 Prostate cancer
    100759762 (Ikbkg)
   05222 Small cell lung cancer
    100759762 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    100759762 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100759762 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100759762 (Ikbkg)
   05135 Yersinia infection
    100759762 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100759762 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    100759762 (Ikbkg)
   05162 Measles
    100759762 (Ikbkg)
   05164 Influenza A
    100759762 (Ikbkg)
   05161 Hepatitis B
    100759762 (Ikbkg)
   05160 Hepatitis C
    100759762 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    100759762 (Ikbkg)
   05163 Human cytomegalovirus infection
    100759762 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100759762 (Ikbkg)
   05169 Epstein-Barr virus infection
    100759762 (Ikbkg)
   05165 Human papillomavirus infection
    100759762 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100759762 (Ikbkg)
   05142 Chagas disease
    100759762 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100759762 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100759762 (Ikbkg)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100759762 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 ERM
Other DBs
NCBI-GeneID: 100759762
NCBI-ProteinID: XP_035306095
LinkDB
Position
X
AA seq 418 aa
MTLPCWMSKHLWKNQLSEMVQPSGGPAGDQDMQGEESSLGKPAMLQLPSEQGTPETLQRC
LEENQELRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDL
QRQREQVLKDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRM
RAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAY
HQLFQDYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVL
KAQADIYKADFQAERHAREKLVEKKELLQEQLEQLQREYSKLKVGCHESARIEDMRKRHV
ETSQPPLLPAPAHHSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacactgccttgttggatgagtaagcacctctggaagaatcagttgagtgaaatggtg
cagcccagtggtggcccagcaggggaccaggacatgcagggtgaagaatcttctctgggg
aagccggcaatgttacagctgccttcagagcagggtactcctgagaccctccagcgctgc
ctggaagagaaccaagagctcagagatgccatccggcagagcaatcagatgctaagggaa
cgctgtgaggagctgctgcattttcaggtcagccagcgggaggagaaggagttcctcatg
tgcaaattccaggaagccaggaagctggtggagagactgagcttggagaagcttgacctg
cagaggcagagggaacaggtcttaaaggatttggagcacctgaagaaatgccaacagcag
atggctgaggacaaggcctctgtgaaagcccaggtgacatcattgttaggggaactccag
gagagccagagtcgcttggaggctgccaccaaagaacgacaaactttagagggaaggatg
cgagcagttagtgagcaggttagacagctggagagtgagcgggaggtgctgcagcagcag
cacagcgtgcaggtggaccagctgcgcatgcagaaccagagtgtggaggctgccctgcga
atggagcgccaggctgcttcagaggagaagcggaagctggctcagttgcaagcagcgtat
catcagctcttccaagactatgacagccacatcaagagcagcaagggaatgcagctggaa
gatttgaggcaacagctccagcaagctgaggaggccctggttgccaaacaggaattgatt
gataaactgaaagaagaagctgagcaacacaagattgtgatggagactgtgccagtccta
aaggcccaggcggatatctacaaggctgacttccaagctgagaggcatgcccgggaaaag
ctggtggagaagaaggagcttttgcaggaacagctggagcagctgcagcgcgagtacagc
aagctgaaggttggctgccatgagtcagccaggattgaggatatgaggaagcgacatgta
gagacttcccagccccctttactccctgctccagctcaccactcctttcatctggctttg
cccaaccagcggagaagtcctcctgaggaaccacctgacttctgttgtcccaagtgccag
tatcaggcacctgatatggacactctacagatacatgtcatggagtgcatagagtag

DBGET integrated database retrieval system