KEGG   Cricetulus griseus (Chinese hamster): 100760062
Entry
100760062         CDS       T02813                                 

Gene name
Nos2
Definition
(RefSeq) nitric oxide synthase, inducible isoform X2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00220  Arginine biosynthesis
cge00330  Arginine and proline metabolism
cge01100  Metabolic pathways
cge04020  Calcium signaling pathway
cge04066  HIF-1 signaling pathway
cge04146  Peroxisome
cge04371  Apelin signaling pathway
cge04926  Relaxin signaling pathway
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05022  Pathways of neurodegeneration - multiple diseases
cge05133  Pertussis
cge05140  Leishmaniasis
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05146  Amoebiasis
cge05152  Tuberculosis
cge05200  Pathways in cancer
cge05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100760062 (Nos2)
   00330 Arginine and proline metabolism
    100760062 (Nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100760062 (Nos2)
   04066 HIF-1 signaling pathway
    100760062 (Nos2)
   04020 Calcium signaling pathway
    100760062 (Nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100760062 (Nos2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100760062 (Nos2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760062 (Nos2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100760062 (Nos2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100760062 (Nos2)
   05014 Amyotrophic lateral sclerosis
    100760062 (Nos2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100760062 (Nos2)
   05152 Tuberculosis
    100760062 (Nos2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100760062 (Nos2)
   05145 Toxoplasmosis
    100760062 (Nos2)
   05140 Leishmaniasis
    100760062 (Nos2)
   05142 Chagas disease
    100760062 (Nos2)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100760062 (Nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 100760062
NCBI-ProteinID: XP_027282358
LinkDB
Position
7
AA seq 1150 aa
MACPWKFLFKAKSYQGDLKEEKDINNNVGKTQSAFPSPTTQDDPKDHRPAKHQNGSPPPL
TGAAQNGLEPLDKPHLSPSTRPQHVKIKNWGSGEILQDTLHHKAMSEFTCKSKSCLGSIM
NPKNLIRGPRDKPTSLEELLPQAIEFINQYYGSFTEAKIEEHLARVEAVTEDIETTGTYQ
LTLDELIFATKLAWRNAPRCIGRIQWANLQVFDARSCSTAQDMFQHICRHLLYATNNGNI
RSAITVFPQRSDGKHDFRIWNSQLIRYAGYQMPDGTIRGDPASLEFTQLCIDLGWKPRYG
RFDVLPLILQADGQDPEVFEIPPNLVLEVTMEHPKYEWFQELGLKWYALPAVANMLLEVG
GLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINV
AVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEPWKTHIWQDGKLRPRRREIRLRVLVKAVLFASMLMRKVMASRVRAT
VLFATETGKSEALAWDLAALFSYAFNTKVVCMNQYKASTLEDEQLLLVVTSTFGNGDCPS
NGQTLKKALFMLRELTHTFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLALTGEGD
ELSGQEDAFRSWAVQTFRTACETFDVRSKHHIQIPKRYTSNAVWEPQQYRLTQSPEPLDL
NKALSSIHAKNVFTMRVKSQQNLQSGKSSRTTLLVQLSFEGSRGPSYLPGEHLGIFPSNQ
VALVQGILERVVDCPSLHQTVCLEVLDESGSYWVKDKRLPPCSLSQALTYFLDITTPPTQ
LQLHKLARLATDDAERQRLEALCQSSEYNDWKFRNNPTFLEVLEEFPSLRVPAAFLLSQL
PILKPRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQGPLHHGVCSTWISSLKPQDPVPCF
VRSVSGFQLPEDPSLPCILIGPGTGIAPFRSFWQQRLHDSQHKGLKGGRMTLVFGCRHPE
EDHLYREEMQEMAHKGVLHEVHTAYSRMPGKPKVYVQDILQKQLANEVLSVLHGEQGHLY
VCGDVRMARDVATTVKKLVATKMNLNEEQVEGYFFQLKSQKRYHEDIFSAVFSYGVKNSS
ALEQPKSTRL
NT seq 3453 nt   +upstreamnt  +downstreamnt
atggcctgcccctggaagtttctgttcaaagccaaatcctaccaaggtgacttgaaggag
gaaaaggacattaacaacaatgtggggaaaacccaaagtgcctttcccagcccaacgaca
caggatgaccctaaggatcacagacctgccaagcaccaaaatggttccccaccacccctc
actggggcagcgcagaatggtctggaacccctggacaagccgcacctgtctccatccacc
cgcccacaacacgtgaaaatcaaaaactggggcagtggagagattttgcaagacaccctt
caccacaaggccatgtcggagttcacctgcaagtccaaatcttgcttggggtccatcatg
aaccccaagaatttgataagaggccccagagataagcccacctccctggaggagcttctg
cctcaagccattgagttcatcaaccagtactatggctccttcactgaggcaaaaatagag
gaacatctggccagggtggaagctgtaacagaggacatagaaacaacaggaacctaccag
ctgacgctggatgagctcatctttgccaccaagctggcctggcggaacgcccctcgctgc
atcggcaggatccagtgggctaacttgcaggtcttcgatgcccggagctgtagcactgcc
caggacatgttccagcacatctgtagacatctgctttatgccaccaacaacggtaacatc
aggtcggccatcactgtgttcccccagcggagcgatgggaagcatgacttccggatctgg
aactctcagctcatcaggtatgctggctaccagatgcccgatggcaccatcagaggggac
cctgccagcttggagttcacccagttgtgcatcgatctgggctggaagcctcgctatggc
cgctttgatgtgctgcctctgatcctgcaggctgacggacaagatccagaggtctttgaa
atccctcctaaccttgtcttggaggtgaccatggagcatcccaagtacgagtggttccag
gagcttgggctgaagtggtatgccctgcctgccgtagccaacatgctgctggaggtgggt
ggtcttgaattcccagcctgccccttcaatggttggtacatgggcacggagattggtgtt
cgagacttctgtgacacacagcgctacaacatccttgaggaagtgggcagaaggatgggc
ctggagacccacacgctggcctccctgtggaaagaccgggctgtcacggagatcaacgtg
gctgttctccatagtttccagaagcagaacgtgaccatcatggaccaccacacagcctca
gagtccttcatgaagcacatgcagaatgagtaccgggcccgaggaggctgccctgcagac
tggatttggctggtccctcccatgtctgggagcatcacccctgtgtttcaccaggagatg
ctgaactatgtcctatctccattctactactatcaggtcgagccctggaagacccatatc
tggcaggatgggaaactgaggcccaggaggagagagatcagactcagagtcttggtgaaa
gcggtgctctttgcttccatgttgatgcgcaaggtcatggcttcccgagtccgagccaca
gtcctctttgctactgagacggggaagtccgaagcgctagcctgggacctggccgccttg
ttcagctatgccttcaacaccaaggttgtctgcatgaaccagtacaaggcaagcaccttg
gaagacgagcagctattgctggtggtgacaagcacgtttgggaacggagactgccccagc
aatgggcagactctgaagaaagctctcttcatgctgagagagctcactcacaccttcagg
tatgccgtgtttggccttggctccagcatgtaccctcagttctgcgcctttgctcatgac
attgaccagaaactgtcccagctgggagcctctcagcttgccctgacaggagaaggggat
gaactcagtgggcaagaggatgccttccgcagctgggctgtgcaaaccttccggacagcc
tgtgagacgtttgatgtccgaagcaaacatcacattcagattccgaaacgctacacttcc
aatgcagtctgggagccacagcaatacaggctcacccagagcccagagcccttagacctc
aacaaagctctcagcagtatacacgccaagaacgtgttcaccatgagggtgaaatcccag
cagaatctgcagagtgggaagtccagccggaccaccctcctcgtccaactctccttcgag
ggcagccgaggccccagctacctgcctggggaacaccttgggattttcccaagtaaccag
gtggctttggtccagggaatcttggagcgagttgtggattgtccttcactgcaccaaacc
gtgtgcctggaggtgctggatgagagcggcagctactgggtcaaggacaagaggctgccc
ccctgctcgctcagccaagccctcacctacttcctggacatcactacccctcccacccag
ctgcagctccacaagctggcccgcctggccacagacgacgctgaaaggcagaggctggag
gccctgtgtcagtcttcagagtacaatgactggaagttcagaaacaaccccacgttcctg
gaggtgctggaagagttcccgtcgcttcgcgtgcctgctgccttcctgctgtcgcagctc
cccattctgaagccccgctactactccatcagctcctcccaggaccacaccccctcagag
gtccatctcactgtggccgtggtcacctatcggacccgagatggtcagggtcccctgcac
catggtgtctgcagcacttggataagtagcctgaagccccaggacccagtgccctgtttt
gtgagaagtgtcagtggcttccagctccctgaagacccctccctgccttgcatcctcatt
gggcctggcacgggcatcgctcccttccgcagtttctggcaacagcgactccatgactcc
cagcacaaagggctcaaaggaggccgcatgaccttggtgtttgggtgccggcacccggag
gaggaccacctctatcgggaagagatgcaggagatggcccacaagggagtgctgcacgag
gtgcatacagcctactcccggatgccaggcaagcccaaggtctacgttcaagacatcctg
cagaagcagctggccaacgaggtactcagcgtgctccacggggagcagggccacctctat
gtttgtggagatgtgcgcatggctcgggatgtggctaccaccgtgaagaagctggtggcc
accaagatgaacttgaacgaggagcaggttgaggggtatttcttccagctcaagagccag
aaacgttatcatgaagacatcttcagcgcagtcttctcctatggggtgaaaaacagcagc
gccttggagcagcccaaaagcacaaggctctga

DBGET integrated database retrieval system