KEGG   Cricetulus griseus (Chinese hamster): 100760122
Entry
100760122         CDS       T02813                                 

Gene name
Cdk4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04530  Tight junction
cge04660  T cell receptor signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05212  Pancreatic cancer
cge05214  Glioma
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100760122 (Cdk4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100760122 (Cdk4)
   04115 p53 signaling pathway
    100760122 (Cdk4)
   04218 Cellular senescence
    100760122 (Cdk4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100760122 (Cdk4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100760122 (Cdk4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760122 (Cdk4)
   05203 Viral carcinogenesis
    100760122 (Cdk4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100760122 (Cdk4)
   05225 Hepatocellular carcinoma
    100760122 (Cdk4)
   05214 Glioma
    100760122 (Cdk4)
   05220 Chronic myeloid leukemia
    100760122 (Cdk4)
   05218 Melanoma
    100760122 (Cdk4)
   05219 Bladder cancer
    100760122 (Cdk4)
   05224 Breast cancer
    100760122 (Cdk4)
   05222 Small cell lung cancer
    100760122 (Cdk4)
   05223 Non-small cell lung cancer
    100760122 (Cdk4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100760122 (Cdk4)
   04934 Cushing syndrome
    100760122 (Cdk4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100760122 (Cdk4)
   05160 Hepatitis C
    100760122 (Cdk4)
   05164 Influenza A
    100760122 (Cdk4)
   05162 Measles
    100760122 (Cdk4)
   05163 Human cytomegalovirus infection
    100760122 (Cdk4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100760122 (Cdk4)
   05169 Epstein-Barr virus infection
    100760122 (Cdk4)
   05165 Human papillomavirus infection
    100760122 (Cdk4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100760122 (Cdk4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100760122 (Cdk4)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100760122 (Cdk4)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100760122 (Cdk4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 100760122
NCBI-ProteinID: XP_027248061
LinkDB
Position
1
AA seq 303 aa
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL
MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
EVSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES
DPE
NT seq 912 nt   +upstreamnt  +downstreamnt
atggctacctcccgctatgaaccggtggctgaaatcggtgttggtgcctatgggacggta
tacaaggcccgagatccccacagtggccactttgtggccctcaagagtgtgcgagttccc
aacggagggggagctggagggggccttcccatcagcactgtacgcgaggtggccttactg
aggcggttggaggccttcgagcaccccaatgttgtacggctaatggatgtctgtgctacc
tcccgaactgatcgagacatcaaggtcactctcgtgtttgagcatatagatcaggatctg
aggacatacctggataaagcacccccaccaggcttgccagttgagaccatcaaggacctg
atgcgacagtttctaagcggcctggattttcttcatgcaaattgcattgttcaccgagac
ctgaaaccggagaacattctggtgactagtaatgggacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggccctcacacctgtggttgttacactctggtac
cgtgctcctgaagttcttctgcagtctacatacgcaacacccgtggacatgtggagcgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct
gaccagttgggcaaaatctttgatctcattggattgcccccagaagatgactggcctcga
gaggtatctcttccccgaggagccttttcccccagagggccgcggcctgtgcagtcggtg
gtaccggagatggaggaatctggagcacagctgctgctggagatgctgacttttaaccca
cataagcggatttctgccttccgagccctgcagcactcttacctacacaaggaagagagt
gacccagagtga

KEGG   Cricetulus griseus (Chinese hamster): 100764515
Entry
100764515         CDS       T02813                                 

Gene name
Cdk6
Definition
(RefSeq) cyclin-dependent kinase 6 isoform X2
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04218  Cellular senescence
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05214  Glioma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100764515 (Cdk6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100764515 (Cdk6)
   04115 p53 signaling pathway
    100764515 (Cdk6)
   04218 Cellular senescence
    100764515 (Cdk6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764515 (Cdk6)
   05206 MicroRNAs in cancer
    100764515 (Cdk6)
   05203 Viral carcinogenesis
    100764515 (Cdk6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100764515 (Cdk6)
   05225 Hepatocellular carcinoma
    100764515 (Cdk6)
   05214 Glioma
    100764515 (Cdk6)
   05220 Chronic myeloid leukemia
    100764515 (Cdk6)
   05218 Melanoma
    100764515 (Cdk6)
   05224 Breast cancer
    100764515 (Cdk6)
   05222 Small cell lung cancer
    100764515 (Cdk6)
   05223 Non-small cell lung cancer
    100764515 (Cdk6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764515 (Cdk6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100764515 (Cdk6)
   05164 Influenza A
    100764515 (Cdk6)
   05162 Measles
    100764515 (Cdk6)
   05163 Human cytomegalovirus infection
    100764515 (Cdk6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100764515 (Cdk6)
   05169 Epstein-Barr virus infection
    100764515 (Cdk6)
   05165 Human papillomavirus infection
    100764515 (Cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100764515 (Cdk6)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100764515 (Cdk6)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100764515 (Cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 100764515
NCBI-ProteinID: XP_027245637
UniProt: G3GXH4
LinkDB
Position
1
AA seq 326 aa
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHAKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYGALSHPYF
QDLERYKDSLHSHLSSSQSTSELNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctgagccgcgccgaccagcagtatgagtgcgtggcggagatcggc
gagggcgcctacgggaaggtgttcaaggcccgcgacctgaagaacggcggccgcttcgtg
gctctgaagcgcgtgcgagtgcagaccggcgaggagggcatgccgctgtccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacggacagacagagagaccaagcttacactagtgtttgagcat
gttgatcaagacttgaccacttacttggataaagttccggagcctggagtccccacagaa
accattaaggacatgatgtttcagctgctccgaggtctggacttccttcattctcaccgc
gtagtgcatcgtgacctaaagccacagaacattctggtgaccagcagcggacaaatcaaa
ctggctgactttggccttgcccgcatctatagttttcaaatggcccttacctcagtggtt
gtcacactgtggtaccgagccccagaagtcttgctccagtccagctacgccacccccgtg
gacctttggagtgtcggctgcatatttgcagaaatgtttcgcagaaagcctctgtttcgt
ggaagttcagacgtggatcaactaggaaaaatcttggatgtgattggacttccgggagaa
gaagactggcccagggatgtggcccttcccaggcaggcttttcatgccaaatctgcccaa
cccatcgagaagttcgtgacagatattgacgaactaggcaaagatctacttctgaaatgc
ttgacgtttaatccagctaaaagaatatctgcctatggcgccctgagtcacccatacttt
caggacctggagaggtacaaagacagcctgcactcccacctgtcatccagccagagcacc
tcagagctgaacacagcctga

DBGET integrated database retrieval system