KEGG   Cricetulus griseus (Chinese hamster): 100760258
Entry
100760258         CDS       T02813                                 

Gene name
Pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha precursor
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04020  Calcium signaling pathway
cge04072  Phospholipase D signaling pathway
cge04144  Endocytosis
cge04151  PI3K-Akt signaling pathway
cge04510  Focal adhesion
cge04540  Gap junction
cge04630  JAK-STAT signaling pathway
cge04810  Regulation of actin cytoskeleton
cge05163  Human cytomegalovirus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100760258 (Pdgfra)
   04014 Ras signaling pathway
    100760258 (Pdgfra)
   04015 Rap1 signaling pathway
    100760258 (Pdgfra)
   04630 JAK-STAT signaling pathway
    100760258 (Pdgfra)
   04020 Calcium signaling pathway
    100760258 (Pdgfra)
   04072 Phospholipase D signaling pathway
    100760258 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    100760258 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100760258 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100760258 (Pdgfra)
   04540 Gap junction
    100760258 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100760258 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760258 (Pdgfra)
   05206 MicroRNAs in cancer
    100760258 (Pdgfra)
   05230 Central carbon metabolism in cancer
    100760258 (Pdgfra)
   05231 Choline metabolism in cancer
    100760258 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    100760258 (Pdgfra)
   05218 Melanoma
    100760258 (Pdgfra)
   05215 Prostate cancer
    100760258 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100760258 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100760258 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100760258 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cge04090]
    100760258 (Pdgfra)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100760258 (Pdgfra)
Protein kinases [BR:cge01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100760258 (Pdgfra)
CD molecules [BR:cge04090]
 Proteins
  100760258 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 C1-set
Other DBs
NCBI-GeneID: 100760258
NCBI-ProteinID: NP_001247445
UniProt: I1SNZ3
LinkDB
AA seq 1089 aa
MGTSHQAFLVLSCLLTGLSLVSCQLLLPSILPNENEKVVQLNSSFSLSCFGESEVSWQHP
MSEEDDPNVEIRNEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTEESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVLASYDSRQGFNG
TFSVGPYICEATVRGRTFKTGEFNVYALKATSELNLEMEARQTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGVTMLEEIKLPSIKLVYTLTVPKATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFVEIKPTFGQLEAVNLHQVREFVVEVQAYPTPKISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNDDDVKSYTFELSTLVPASILEL
VDDHHGSGGGQTVRCTAEGTPLPDIEWMICKDIKKCNNDTSWTTLASNVSNIITEFHRRG
RSTVEGRVSFAKVEETIAVRCLAKNDLGTGNRELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSGDKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSENSYIGVTYKNEDDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSRTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggccttcctggtcctcagctgtctcctcacggggctgagcctc
gtctcctgccagctcttattaccctccatccttccgaacgagaatgagaaggttgtgcag
ctgaattcgtccttttctctgagctgctttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaatgtggaaatcagaaatgaggagaacaacagtggcctc
tttgtgacagtgctggaagtcgtcaacgcctcagcggcccacaccggatggtacacttgc
tattacaaccacactcagacggaagagagtgagattgaaggcaggcacatttacatctat
gtgccagacccagacatggcctttgtgccattagggatgacggattctttagtcatcgtg
gaagaggatgattctgccatcataccttgtcgcaccacagatccagaaactcaagtaacc
ttgcacaataatggtaggctggtgctggcctcttacgacagcaggcagggtttcaacggg
accttcagtgtggggccatatatctgtgaggccaccgtcagagggaggacattcaagacc
ggcgaatttaacgtttatgctttgaaagcaacgtcagaactgaatctggagatggaagcc
cgccagactgtgtataagtcaggggaaacgattgtggtcacctgtgctgtcttcaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgagaaacaaaggcgtcaccatg
ctggaggagatcaaactcccatccatcaaattggtgtacactttgacagtccccaaggct
acagtgaaagacagtggagattatgaatgtgctgcccgccaggccactaaggaggtcaaa
gaaatgaagaaagtcaccatttccgtccacgagaaaggttttgttgagatcaaacccacc
tttggccagctggaagctgtcaacttgcatcaggtccgagagtttgtggtggaggtgcag
gcctaccctactcccaagatatcctggctgaaggacaacttgactctgattgagaatctc
actgagatcaccactgatgtgcagaagagccaggaaacaagatatcaaagcaaattaaag
ctgatccgggccaaggaagaagacagtggccattataccattatagttcaaaatgacgat
gacgtgaagagttacacgtttgagctgtcaactctagttcctgcatccatcctggagctt
gtggatgaccaccatggttctggcgggggacagactgtgagatgcacagctgaaggcaca
ccacttccggacatcgagtggatgatctgcaaggatattaagaaatgtaataatgacact
tcatggacaactttggccagcaacgtctcaaatatcatcacagagttccatcgccgaggc
aggagtactgtagagggacgagtgtcctttgccaaagtggaagagaccattgcagttcga
tgcctggcaaagaatgaccttggcactgggaaccgagagctgaagctggtggctcctacc
ctgcgttctgaactcacggtggcggctgcagtgttggtactgttggtgattgtcatcgtt
tctctcattgtcctggttgtcatttggaagcagaagccacgctatgaaattcgctggagg
gtcattgagtctatcagccccgatggacacgaatatatttatgtggatccaatgcagctg
ccttacgactccagatgggaattcccgagggatggactagtgcttggtcggatcttagga
tctggtgcatttgggaaagtggttgaaggcacagcctatggattaagccggtcccagcct
gttatgaaggtggcagtaaagatgcttaaacctacagcaagatccagtgaaaagcaagct
ctcatgtctgagctgaagataatgacccacttgggaccacacttgaacatcgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcattactgagtactgcttctatggt
gatttggtcaactatttgcataagaatcgagatagcttcatgagccggcacccagagaag
ccaaagaaagagctggacatctttggattgaatcctgccgacgacagtacaaggagttat
gtgattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgctcgaaaggaaagaagtctctaaatactctgacatccagagatcg
ctgtatgatcggccagcttcctataagaagaaatctatgctagactcaggagacaaaaac
ctcctttctgatgatgactccgagggtcttactttgctggatttattgagcttcacctat
caagttgcccgaggaatggaatttttggcttccaaaaattgcgtccaccgggacctggct
gcccgcaacgtacttctggcacaagggaaaattgtaaagatctgtgactttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctataccacactgagtgacgtctggtct
tacggcattttgctctgggaaatcttttcccttggtggcacaccctaccctggcatgatg
gttgattctactttctacaataagatcaagagtggataccggatggccaagcctgatcat
gccaccagtgaagtctatgagattatggtgcagtgctggaacagtgaacctgaaaagaga
ccctccttctaccacctgagtgagatagtagagaatctgctgcctggacaatataaaaag
agttatgaaaagattcacctggacttcctaaagagtgaccatccggccgtggcacgaatg
cgcgtggactctgagaactcgtacattggtgtcacttacaaaaatgaagatgacaagctg
aaggactgggaaggtggcctggatgaacagagactgagtgcagacagtggctacattatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcgagaacctctgaagagagtgccatcgagactggttccagcagttccaccttcatc
aagagagaggatgagaccattgaggacatcgacatgatggatgacattggcatagactcc
tcagacctggtggaggacagctttctgtaa

DBGET integrated database retrieval system