KEGG   Cricetulus griseus (Chinese hamster): 100760320Help
Entry
100760320         CDS       T02813                                 

Gene name
Sod2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04068  FoxO signaling pathway
cge04146  Peroxisome
cge04211  Longevity regulating pathway
cge04213  Longevity regulating pathway - multiple species
cge05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100760320 (Sod2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100760320 (Sod2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    100760320 (Sod2)
   04213 Longevity regulating pathway - multiple species
    100760320 (Sod2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    100760320 (Sod2)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100760320 (Sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100760320
NCBI-ProteinID: XP_003507617
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACSAGRRLAPAARGAGCRRKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEEKYREALAKGDVTTQVALQPALKFNGGGHINHSIFWTNLSPKGGGEPKGELLEA
IKRDFGSFEKFKEKLTAVSAGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERFTACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgtcgggcggcttgcagcgccggcaggaggctggccccggcggcgaggggcgcg
ggctgccggcgtaagcacagcctcccggacctgccttacgactatggcgcgctggagccg
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctgaacgccaccgaggagaagtaccgcgaggccctggccaagggagatgttacgact
caggttgctcttcaacctgccctgaagttcaatggtgggggacatatcaatcactccatt
ttctggacaaacctgagccctaaaggtggtggagaacccaaaggagagttgctggaggct
atcaaacgtgactttggatcttttgagaagtttaaggagaagctgactgctgtgtctgct
ggagttcaaggttcaggctggggctggcttggcttcaataaggagcagggtcgcttacag
attgctgcctgctctaatcaggacccactgcaaggaaccacaggccttattcctctgttg
gggatcgacgtgtgggagcatgcctattaccttcagtataaaaatgtcagacccgattat
ctgaaggctatttggaatgtaatcaactgggagaatgtcactgaaagattcacagcttgc
aagaagtaa

DBGET integrated database retrieval system