KEGG   Cricetulus griseus (Chinese hamster): 100760426
Entry
100760426         CDS       T02813                                 

Gene name
Bad
Definition
(RefSeq) bcl2-associated agonist of cell death isoform X2
  KO
K02158  Bcl-2-antagonist of cell death
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04140  Autophagy - animal
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04370  VEGF signaling pathway
cge04510  Focal adhesion
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05145  Toxoplasmosis
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05165  Human papillomavirus infection
cge05168  Herpes simplex virus 1 infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05215  Prostate cancer
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100760426 (Bad)
   04014 Ras signaling pathway
    100760426 (Bad)
   04370 VEGF signaling pathway
    100760426 (Bad)
   04024 cAMP signaling pathway
    100760426 (Bad)
   04022 cGMP-PKG signaling pathway
    100760426 (Bad)
   04151 PI3K-Akt signaling pathway
    100760426 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100760426 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    100760426 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100760426 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100760426 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100760426 (Bad)
   04919 Thyroid hormone signaling pathway
    100760426 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100760426 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760426 (Bad)
   05203 Viral carcinogenesis
    100760426 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100760426 (Bad)
   05212 Pancreatic cancer
    100760426 (Bad)
   05225 Hepatocellular carcinoma
    100760426 (Bad)
   05221 Acute myeloid leukemia
    100760426 (Bad)
   05220 Chronic myeloid leukemia
    100760426 (Bad)
   05218 Melanoma
    100760426 (Bad)
   05211 Renal cell carcinoma
    100760426 (Bad)
   05215 Prostate cancer
    100760426 (Bad)
   05213 Endometrial cancer
    100760426 (Bad)
   05223 Non-small cell lung cancer
    100760426 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100760426 (Bad)
   05014 Amyotrophic lateral sclerosis
    100760426 (Bad)
   05020 Prion disease
    100760426 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    100760426 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100760426 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100760426 (Bad)
   05161 Hepatitis B
    100760426 (Bad)
   05160 Hepatitis C
    100760426 (Bad)
   05162 Measles
    100760426 (Bad)
   05168 Herpes simplex virus 1 infection
    100760426 (Bad)
   05165 Human papillomavirus infection
    100760426 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100760426 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100760426 (Bad)
   01524 Platinum drug resistance
    100760426 (Bad)
   01522 Endocrine resistance
    100760426 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100760426
NCBI-ProteinID: XP_027264249
LinkDB
Position
3
AA seq 204 aa
MGTPKQPSLAPAHALGVRKSDPGIRSLGNDAGGRRRRPAAQSMFQIPEFEPSEQEDSNTA
ERGLGPSLTGDQPGPCLAPGLLGSIRHQQEQAANSSHHGGTGAMEIRSRHSSYTAGNEED
DGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQS
ASWTRIIQSWWDRNLGKGGSAPSQ
NT seq 615 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagcagccctcgctggctcctgcacacgccctaggcgtgaggaagtcc
gatcccggaatccggagcctggggaacgacgcaggaggaaggcggcggagaccagcagcc
cagagtatgttccagatcccagagtttgagcccagtgagcaggaagactccaatactgca
gaaaggggcctgggccctagcctcactggggaccagccaggtccctgcctggccccaggt
ctcctggggagcatcagacaccaacaggaacaggcagccaacagcagtcatcatggaggc
actggggctatggagatccggagtcgccacagttcatacaccgcggggaacgaggaggat
gacgggatggaggaggagctcagcccatttcgcggccgctcacgttcggctccccctaat
ctctgggctgcgcagcgctacggccgcgagctccgaaggatgagcgatgagtttgagggt
tccttcaagggacttcctcgcccaaagagcgcaggaactgcaacacagatgcgacaaagc
gccagctggacgcgcattatccagtcctggtgggatcgaaacttgggcaaaggaggctcc
gccccctctcagtga

DBGET integrated database retrieval system