KEGG   Cricetulus griseus (Chinese hamster): 100760865
Entry
100760865         CDS       T02813                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X7
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge04012  ErbB signaling pathway
cge04062  Chemokine signaling pathway
cge04110  Cell cycle
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04360  Axon guidance
cge04390  Hippo signaling pathway
cge04510  Focal adhesion
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04657  IL-17 signaling pathway
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04722  Neurotrophin signaling pathway
cge04728  Dopaminergic synapse
cge04910  Insulin signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05135  Yersinia infection
cge05160  Hepatitis C
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05215  Prostate cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100760865 (Gsk3b)
   04310 Wnt signaling pathway
    100760865 (Gsk3b)
   04340 Hedgehog signaling pathway
    100760865 (Gsk3b)
   04390 Hippo signaling pathway
    100760865 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    100760865 (Gsk3b)
   04150 mTOR signaling pathway
    100760865 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100760865 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100760865 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    100760865 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100760865 (Gsk3b)
   04657 IL-17 signaling pathway
    100760865 (Gsk3b)
   04662 B cell receptor signaling pathway
    100760865 (Gsk3b)
   04062 Chemokine signaling pathway
    100760865 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100760865 (Gsk3b)
   04917 Prolactin signaling pathway
    100760865 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    100760865 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    100760865 (Gsk3b)
   04916 Melanogenesis
    100760865 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    100760865 (Gsk3b)
   04722 Neurotrophin signaling pathway
    100760865 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    100760865 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100760865 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100760865 (Gsk3b)
   05225 Hepatocellular carcinoma
    100760865 (Gsk3b)
   05226 Gastric cancer
    100760865 (Gsk3b)
   05217 Basal cell carcinoma
    100760865 (Gsk3b)
   05215 Prostate cancer
    100760865 (Gsk3b)
   05213 Endometrial cancer
    100760865 (Gsk3b)
   05224 Breast cancer
    100760865 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100760865 (Gsk3b)
   05020 Prion disease
    100760865 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    100760865 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100760865 (Gsk3b)
   04931 Insulin resistance
    100760865 (Gsk3b)
   04934 Cushing syndrome
    100760865 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100760865 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100760865 (Gsk3b)
   05162 Measles
    100760865 (Gsk3b)
   05163 Human cytomegalovirus infection
    100760865 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100760865 (Gsk3b)
   05165 Human papillomavirus infection
    100760865 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100760865 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100760865 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100760865 (Gsk3b)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100760865 (Gsk3b)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100760865 (Gsk3b)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100760865 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100760865
NCBI-ProteinID: XP_027268498
UniProt: A0A061I155
LinkDB
Position
4
AA seq 436 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNTTASSDMIVPISCESKGHTWASHMKIC
YSCYSCQDFRHVNSGC
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcagagagctgcaagccagtgcagcagcct
tcagcttttggtagcatgaaagttagcagagataaagatggcagcaaggtgaccactgtg
gtggcaactcctggacagggtcctgacagaccacaggaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaaaaaagttttgcaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagatcattgtaacatagtccgattgcggtatttcttctactcaagtggt
gagaagaaagatgaggtctaccttaatctggtgctggactatgttccggaaacagtgtat
agagttgccagacactatagtcgagccaaacagacactccctgtgatctatgtcaagttg
tatatgtatcagctgttcagaagtttagcctatatccattcctttggaatctgccatcga
gatattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcctatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagcatagatgta
tggtctgcaggatgtgtattggctgagttgttgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaatttcctcaaatcaaggcacatcct
tggacaaaggtcttccggccccgaactccaccagaggcaattgcactgtgtagccgtcta
ctggagtatacaccaaccgcccgattaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aactttaccactcaagaactgtcaagtaacccgcctctggccaccatccttattcctccc
catgctcggattcaagcagctgcttccacccctacgaacaccacagcatcctcagacatg
attgtccccatttcctgtgaaagcaagggacacacctgggcatcccacatgaagatctgc
tactcctgctattcatgtcaagactttagacacgtgaacagtggctgctga

DBGET integrated database retrieval system